Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2WZG1

Protein Details
Accession V2WZG1    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
188-207YSLYRKLKSQRKTGYYRFSPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036389  RNase_III_sf  
Gene Ontology GO:0004525  F:ribonuclease III activity  
GO:0006396  P:RNA processing  
KEGG mrr:Moror_4760  -  
Amino Acid Sequences MRSYTSSITKHRRVFNIRHSLNGVRRCGYGSKRSQATPNQQNRSQISISRAIQREVNRAIAELDEVIPPQLTPEAQSLFYDDSDYNAWRGLETTGDAMQSILVMEVTMGCIPEAPIGDMKFIANILETNETIHYLVARMRGVDHSLLIGKTAGCALEMIIGMLTRGGGVETARAWYSSYYPPIVQRAYSLYRKLKSQRKTGYYRFSPVCSGSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.77
4 0.69
5 0.66
6 0.64
7 0.62
8 0.62
9 0.6
10 0.53
11 0.44
12 0.43
13 0.42
14 0.44
15 0.42
16 0.44
17 0.44
18 0.49
19 0.51
20 0.53
21 0.56
22 0.59
23 0.63
24 0.64
25 0.66
26 0.65
27 0.65
28 0.69
29 0.65
30 0.62
31 0.53
32 0.46
33 0.4
34 0.4
35 0.39
36 0.41
37 0.39
38 0.35
39 0.38
40 0.38
41 0.4
42 0.35
43 0.36
44 0.28
45 0.26
46 0.25
47 0.21
48 0.18
49 0.12
50 0.11
51 0.08
52 0.07
53 0.07
54 0.07
55 0.06
56 0.06
57 0.06
58 0.05
59 0.07
60 0.09
61 0.11
62 0.11
63 0.12
64 0.13
65 0.13
66 0.13
67 0.13
68 0.11
69 0.11
70 0.12
71 0.12
72 0.1
73 0.11
74 0.1
75 0.08
76 0.09
77 0.08
78 0.07
79 0.07
80 0.08
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.05
87 0.05
88 0.03
89 0.03
90 0.02
91 0.02
92 0.02
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.04
100 0.05
101 0.05
102 0.07
103 0.07
104 0.08
105 0.08
106 0.08
107 0.07
108 0.07
109 0.06
110 0.04
111 0.04
112 0.06
113 0.07
114 0.07
115 0.08
116 0.08
117 0.09
118 0.09
119 0.08
120 0.07
121 0.06
122 0.07
123 0.09
124 0.09
125 0.09
126 0.09
127 0.11
128 0.12
129 0.12
130 0.11
131 0.09
132 0.11
133 0.11
134 0.1
135 0.1
136 0.08
137 0.08
138 0.08
139 0.07
140 0.05
141 0.05
142 0.05
143 0.06
144 0.06
145 0.06
146 0.06
147 0.06
148 0.05
149 0.05
150 0.05
151 0.03
152 0.03
153 0.03
154 0.04
155 0.04
156 0.05
157 0.06
158 0.08
159 0.08
160 0.09
161 0.1
162 0.1
163 0.14
164 0.17
165 0.2
166 0.21
167 0.22
168 0.25
169 0.3
170 0.3
171 0.27
172 0.24
173 0.27
174 0.31
175 0.35
176 0.4
177 0.42
178 0.43
179 0.51
180 0.59
181 0.62
182 0.63
183 0.68
184 0.7
185 0.72
186 0.79
187 0.8
188 0.81
189 0.77
190 0.78
191 0.71
192 0.64
193 0.59