Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2YSX8

Protein Details
Accession V2YSX8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
59-85DNVQRSSTRVKNKKYRKMRLSEPGLHIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
KEGG mrr:Moror_14254  -  
Amino Acid Sequences MTAPILTPPCCSYLKNSTLHQLRELTNNIATPEATPKASYQLLKCCMEEDVGHESGREDNVQRSSTRVKNKKYRKMRLSEPGLHILIRRNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.39
4 0.44
5 0.49
6 0.5
7 0.47
8 0.42
9 0.37
10 0.38
11 0.39
12 0.32
13 0.27
14 0.26
15 0.23
16 0.2
17 0.18
18 0.14
19 0.15
20 0.14
21 0.13
22 0.12
23 0.12
24 0.15
25 0.17
26 0.19
27 0.17
28 0.22
29 0.26
30 0.27
31 0.27
32 0.24
33 0.22
34 0.2
35 0.18
36 0.15
37 0.15
38 0.15
39 0.14
40 0.14
41 0.14
42 0.14
43 0.15
44 0.13
45 0.09
46 0.12
47 0.15
48 0.17
49 0.17
50 0.2
51 0.26
52 0.32
53 0.42
54 0.46
55 0.53
56 0.62
57 0.73
58 0.79
59 0.84
60 0.87
61 0.86
62 0.86
63 0.85
64 0.85
65 0.83
66 0.81
67 0.75
68 0.7
69 0.62
70 0.54
71 0.47