Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2Y4Y7

Protein Details
Accession V2Y4Y7   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
182-207AIQDRRAANPRKKLKTEPKVKVEVKTHydrophilic
NLS Segment(s)
PositionSequence
186-200RRAANPRKKLKTEPK
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 7
Family & Domain DBs
KEGG mrr:Moror_15204  -  
Amino Acid Sequences MEDYLLMVIIMVVKSYASKTKTMLLGKVQGYHSIRFDLVFSRLNTTDDDDAATGSSSPEIGEIRVVITRTHVKCVHHDPESVIISIPQSQTFHEKSKKAVDHQTSFGAAVPFDKPNIVNVRDYGNPVAQFRFRYRPLDMLQANGMAPLPQTRKRPSKPDTEIIELSDDSDEELARLQARVKAIQDRRAANPRKKLKTEPKVKVEVKTEPLKGEFIDLTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.16
4 0.16
5 0.19
6 0.21
7 0.26
8 0.33
9 0.35
10 0.37
11 0.36
12 0.41
13 0.4
14 0.43
15 0.39
16 0.4
17 0.39
18 0.38
19 0.35
20 0.29
21 0.28
22 0.23
23 0.23
24 0.18
25 0.19
26 0.21
27 0.2
28 0.23
29 0.24
30 0.24
31 0.24
32 0.25
33 0.23
34 0.19
35 0.19
36 0.14
37 0.13
38 0.12
39 0.11
40 0.07
41 0.06
42 0.06
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.09
52 0.1
53 0.08
54 0.12
55 0.2
56 0.2
57 0.26
58 0.28
59 0.28
60 0.33
61 0.41
62 0.42
63 0.36
64 0.36
65 0.31
66 0.34
67 0.34
68 0.29
69 0.21
70 0.16
71 0.14
72 0.15
73 0.15
74 0.11
75 0.1
76 0.1
77 0.16
78 0.18
79 0.24
80 0.28
81 0.28
82 0.3
83 0.37
84 0.39
85 0.38
86 0.43
87 0.43
88 0.4
89 0.41
90 0.39
91 0.31
92 0.29
93 0.26
94 0.18
95 0.12
96 0.1
97 0.09
98 0.08
99 0.08
100 0.08
101 0.07
102 0.11
103 0.15
104 0.16
105 0.15
106 0.15
107 0.18
108 0.19
109 0.2
110 0.18
111 0.16
112 0.15
113 0.15
114 0.16
115 0.15
116 0.17
117 0.19
118 0.24
119 0.25
120 0.27
121 0.28
122 0.32
123 0.31
124 0.37
125 0.34
126 0.29
127 0.27
128 0.24
129 0.22
130 0.17
131 0.15
132 0.07
133 0.07
134 0.1
135 0.14
136 0.19
137 0.25
138 0.32
139 0.42
140 0.47
141 0.56
142 0.57
143 0.63
144 0.64
145 0.67
146 0.65
147 0.61
148 0.56
149 0.48
150 0.45
151 0.34
152 0.29
153 0.2
154 0.15
155 0.09
156 0.09
157 0.08
158 0.05
159 0.06
160 0.06
161 0.07
162 0.08
163 0.09
164 0.12
165 0.15
166 0.17
167 0.2
168 0.29
169 0.33
170 0.41
171 0.45
172 0.46
173 0.51
174 0.59
175 0.65
176 0.64
177 0.69
178 0.71
179 0.74
180 0.76
181 0.8
182 0.81
183 0.82
184 0.85
185 0.84
186 0.82
187 0.83
188 0.81
189 0.77
190 0.72
191 0.68
192 0.64
193 0.62
194 0.57
195 0.5
196 0.48
197 0.43
198 0.38
199 0.34
200 0.28