Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2Y8R9

Protein Details
Accession V2Y8R9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
164-188IARAKREANERQKQKEKERISQSKPHydrophilic
NLS Segment(s)
PositionSequence
98-103RSRKRK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
KEGG mrr:Moror_10763  -  
Amino Acid Sequences MMATSLPPASNFSLSITMPTVLPGCKELLSLGQLPRPTSVYSHTTHHRHAHTSNSESQNRRLSLVEDFSQSYTDLGRRCTRHKPYPTRDDFGGGRGQRSRKRKDTFDREEQRKAKLENDPWSDKTRLTPKSVFCLGCKRVIRLDRRNDYYPGLWLKHRELCQGIARAKREANERQKQKEKERISQSKPSIDDEEAAKILVEMMIKNRCFLNDSPRSPSLSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.19
4 0.17
5 0.15
6 0.16
7 0.16
8 0.13
9 0.14
10 0.13
11 0.13
12 0.13
13 0.13
14 0.12
15 0.13
16 0.16
17 0.19
18 0.2
19 0.22
20 0.23
21 0.24
22 0.25
23 0.25
24 0.22
25 0.19
26 0.22
27 0.23
28 0.23
29 0.27
30 0.34
31 0.36
32 0.41
33 0.46
34 0.45
35 0.45
36 0.45
37 0.49
38 0.47
39 0.47
40 0.5
41 0.51
42 0.54
43 0.53
44 0.56
45 0.54
46 0.49
47 0.46
48 0.38
49 0.32
50 0.29
51 0.3
52 0.26
53 0.2
54 0.21
55 0.19
56 0.19
57 0.17
58 0.14
59 0.11
60 0.13
61 0.12
62 0.15
63 0.21
64 0.24
65 0.28
66 0.38
67 0.45
68 0.52
69 0.61
70 0.67
71 0.7
72 0.77
73 0.78
74 0.72
75 0.64
76 0.58
77 0.48
78 0.4
79 0.38
80 0.27
81 0.24
82 0.25
83 0.3
84 0.33
85 0.41
86 0.47
87 0.49
88 0.54
89 0.61
90 0.67
91 0.71
92 0.72
93 0.75
94 0.77
95 0.72
96 0.76
97 0.69
98 0.63
99 0.56
100 0.49
101 0.43
102 0.4
103 0.4
104 0.39
105 0.43
106 0.43
107 0.42
108 0.45
109 0.41
110 0.35
111 0.35
112 0.35
113 0.32
114 0.34
115 0.36
116 0.33
117 0.38
118 0.43
119 0.39
120 0.33
121 0.38
122 0.35
123 0.38
124 0.38
125 0.34
126 0.35
127 0.41
128 0.48
129 0.49
130 0.57
131 0.57
132 0.62
133 0.63
134 0.59
135 0.55
136 0.47
137 0.43
138 0.37
139 0.31
140 0.28
141 0.28
142 0.3
143 0.33
144 0.34
145 0.33
146 0.3
147 0.32
148 0.35
149 0.38
150 0.39
151 0.39
152 0.39
153 0.39
154 0.39
155 0.39
156 0.4
157 0.44
158 0.49
159 0.54
160 0.6
161 0.66
162 0.74
163 0.79
164 0.81
165 0.82
166 0.78
167 0.78
168 0.8
169 0.8
170 0.78
171 0.79
172 0.75
173 0.72
174 0.66
175 0.62
176 0.55
177 0.46
178 0.41
179 0.33
180 0.32
181 0.25
182 0.23
183 0.18
184 0.13
185 0.13
186 0.11
187 0.11
188 0.08
189 0.14
190 0.21
191 0.22
192 0.23
193 0.24
194 0.24
195 0.27
196 0.29
197 0.34
198 0.36
199 0.41
200 0.47
201 0.49