Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2X3B8

Protein Details
Accession V2X3B8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
65-87QDLFPRSRKMRRGRMGGIRKREWBasic
NLS Segment(s)
PositionSequence
70-85RSRKMRRGRMGGIRKR
Subcellular Location(s) nucl 9.5, cyto_nucl 7.333, cysk 7, cyto_mito 4.333, cyto 4, mito 3.5
Family & Domain DBs
KEGG mrr:Moror_5762  -  
Amino Acid Sequences MSFSFFPSARNLTVEGGNFVNIDGITPGVVISGTTFILSKSNTSTFPTGTYTGAQIQTIEPRSIQDLFPRSRKMRRGRMGGIRKREWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.17
4 0.17
5 0.15
6 0.13
7 0.12
8 0.09
9 0.08
10 0.06
11 0.06
12 0.05
13 0.05
14 0.05
15 0.04
16 0.04
17 0.03
18 0.03
19 0.04
20 0.04
21 0.05
22 0.05
23 0.05
24 0.07
25 0.07
26 0.08
27 0.09
28 0.11
29 0.12
30 0.14
31 0.15
32 0.13
33 0.14
34 0.16
35 0.15
36 0.14
37 0.14
38 0.13
39 0.14
40 0.14
41 0.13
42 0.11
43 0.11
44 0.15
45 0.16
46 0.16
47 0.13
48 0.14
49 0.16
50 0.17
51 0.17
52 0.19
53 0.24
54 0.28
55 0.34
56 0.41
57 0.44
58 0.5
59 0.59
60 0.63
61 0.67
62 0.71
63 0.74
64 0.75
65 0.8
66 0.83
67 0.83
68 0.83