Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2X879

Protein Details
Accession V2X879   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-31RYKDQICRFHKLERRKRPQRHSNEDGTFRBasic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001000  GH10_dom  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0031176  F:endo-1,4-beta-xylanase activity  
GO:0005975  P:carbohydrate metabolic process  
KEGG mrr:Moror_3053  -  
Pfam View protein in Pfam  
PF00331  Glyco_hydro_10  
Amino Acid Sequences MGRYKDQICRFHKLERRKRPQRHSNEDGTFRSFVFYDTLGKSYIDIALQAARAADPDVKLYINDYNIDGLGAKSTVHVQSRQGSHKARDTPIGGHWYSGPPHRRISPREHSSELCSNSLPLVLKLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.74
3 0.8
4 0.83
5 0.9
6 0.91
7 0.93
8 0.93
9 0.91
10 0.87
11 0.86
12 0.81
13 0.77
14 0.69
15 0.62
16 0.52
17 0.42
18 0.36
19 0.26
20 0.2
21 0.16
22 0.14
23 0.14
24 0.14
25 0.15
26 0.15
27 0.14
28 0.14
29 0.13
30 0.13
31 0.09
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.06
38 0.05
39 0.06
40 0.06
41 0.07
42 0.06
43 0.07
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.08
53 0.08
54 0.08
55 0.07
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.06
62 0.09
63 0.1
64 0.12
65 0.14
66 0.19
67 0.24
68 0.28
69 0.33
70 0.34
71 0.36
72 0.42
73 0.44
74 0.41
75 0.4
76 0.38
77 0.34
78 0.34
79 0.36
80 0.29
81 0.25
82 0.24
83 0.22
84 0.23
85 0.28
86 0.3
87 0.28
88 0.32
89 0.39
90 0.45
91 0.47
92 0.54
93 0.58
94 0.59
95 0.63
96 0.62
97 0.58
98 0.58
99 0.61
100 0.55
101 0.46
102 0.39
103 0.33
104 0.29
105 0.29
106 0.24