Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V2X257

Protein Details
Accession V2X257    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-46AIKTPIVKKRTKAFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-52KKRTKAFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) nucl 14.5, mito_nucl 12, mito 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mrr:Moror_15274  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAIKTPIVKKRTKAFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLLPNGLKKFLVSNVKELELLLMHNKSYAAEIAHNVSSRNRTTILERAKVLGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.85
4 0.89
5 0.87
6 0.86
7 0.84
8 0.83
9 0.79
10 0.73
11 0.64
12 0.6
13 0.59
14 0.59
15 0.61
16 0.61
17 0.59
18 0.57
19 0.58
20 0.61
21 0.63
22 0.64
23 0.64
24 0.66
25 0.71
26 0.78
27 0.83
28 0.76
29 0.73
30 0.71
31 0.67
32 0.67
33 0.64
34 0.64
35 0.63
36 0.65
37 0.59
38 0.52
39 0.46
40 0.37
41 0.37
42 0.33
43 0.35
44 0.4
45 0.41
46 0.42
47 0.45
48 0.47
49 0.47
50 0.45
51 0.47
52 0.45
53 0.53
54 0.54
55 0.52
56 0.47
57 0.4
58 0.36
59 0.32
60 0.32
61 0.22
62 0.25
63 0.25
64 0.26
65 0.25
66 0.24
67 0.2
68 0.12
69 0.12
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.1
78 0.08
79 0.09
80 0.1
81 0.13
82 0.14
83 0.15
84 0.15
85 0.17
86 0.2
87 0.21
88 0.22
89 0.21
90 0.21
91 0.25
92 0.33
93 0.37
94 0.37
95 0.37
96 0.37
97 0.38
98 0.37
99 0.33
100 0.3
101 0.24
102 0.21
103 0.24
104 0.28
105 0.27
106 0.27
107 0.31
108 0.28