Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5HG20

Protein Details
Accession U5HG20   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
9-28NSAVVRNRCRRRFKEAVRLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
IPR000100  RNase_P  
Gene Ontology GO:0004526  F:ribonuclease P activity  
GO:0000049  F:tRNA binding  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF00825  Ribonuclease_P  
Amino Acid Sequences MASKKGVHNSAVVRNRCRRRFKEAVRLVVTREAQGGKGGEGQVVEVDEGGVKGPRRWLIPGYTYIVNLTLEVYKQPLSTMVNEIRQGFLQVKSKTNETAYRNLIDSIEVPEEEEAADSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.73
4 0.78
5 0.73
6 0.74
7 0.79
8 0.79
9 0.81
10 0.78
11 0.78
12 0.73
13 0.69
14 0.61
15 0.57
16 0.48
17 0.38
18 0.32
19 0.23
20 0.18
21 0.2
22 0.18
23 0.12
24 0.14
25 0.13
26 0.11
27 0.11
28 0.1
29 0.08
30 0.08
31 0.07
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.06
38 0.06
39 0.07
40 0.09
41 0.11
42 0.12
43 0.14
44 0.15
45 0.16
46 0.18
47 0.19
48 0.2
49 0.19
50 0.18
51 0.16
52 0.15
53 0.13
54 0.11
55 0.09
56 0.06
57 0.06
58 0.06
59 0.08
60 0.07
61 0.07
62 0.07
63 0.09
64 0.1
65 0.11
66 0.16
67 0.18
68 0.21
69 0.22
70 0.23
71 0.22
72 0.2
73 0.21
74 0.18
75 0.19
76 0.24
77 0.24
78 0.29
79 0.31
80 0.33
81 0.34
82 0.36
83 0.39
84 0.36
85 0.41
86 0.39
87 0.39
88 0.38
89 0.36
90 0.32
91 0.26
92 0.22
93 0.19
94 0.18
95 0.15
96 0.15
97 0.14
98 0.14
99 0.13