Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5H5S6

Protein Details
Accession U5H5S6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
220-242MDPENPPKVKRRKIIKAKKYVVLHydrophilic
NLS Segment(s)
PositionSequence
226-238PKVKRRKIIKAKK
Subcellular Location(s) cyto 13.5, cyto_nucl 8, mito 4, pero 4, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
IPR012132  GMC_OxRdtase  
IPR000172  GMC_OxRdtase_N  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0016614  F:oxidoreductase activity, acting on CH-OH group of donors  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF00732  GMC_oxred_N  
PROSITE View protein in PROSITE  
PS00624  GMC_OXRED_2  
Amino Acid Sequences MLLLIPFPPALIGPLPDRLRHRPPLRTTNSFYQTVPDDKTNGRAVVVAAGGLLGGGSSINFQLYTRASASDYDDWNTEGWAFKDLLPLACKTETNTLQDQDWEVHGRNGPLGVSYGGSESALGEEWIRAAAECWPELPFTYDAQDFKTGHAVSKSGKWIDQKGHRSDAAHGFIHPILESYPKLKLITEHKTIRVVFDESGDEPRAISVEVCFNPLARNAMDPENPPKVKRRKIIKAKKYVVLSAGALSTPAILERSGVGKAGVLKEAGVDKVVSELNGVGENYNDHQLASAIYVLADEADTLCELLRGTPEVVEAESALGANGGAGRIATNGIDAAVKLRPTDQEAKKMGPDFQKRWEDKLRCKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.29
4 0.35
5 0.41
6 0.48
7 0.56
8 0.61
9 0.62
10 0.69
11 0.75
12 0.77
13 0.77
14 0.76
15 0.76
16 0.74
17 0.66
18 0.57
19 0.5
20 0.46
21 0.43
22 0.4
23 0.32
24 0.31
25 0.3
26 0.35
27 0.35
28 0.31
29 0.27
30 0.24
31 0.22
32 0.2
33 0.19
34 0.13
35 0.09
36 0.08
37 0.07
38 0.06
39 0.05
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.04
46 0.05
47 0.05
48 0.05
49 0.09
50 0.11
51 0.14
52 0.14
53 0.15
54 0.16
55 0.17
56 0.22
57 0.24
58 0.24
59 0.23
60 0.22
61 0.22
62 0.21
63 0.2
64 0.16
65 0.12
66 0.11
67 0.12
68 0.12
69 0.12
70 0.17
71 0.17
72 0.2
73 0.2
74 0.2
75 0.21
76 0.21
77 0.21
78 0.19
79 0.25
80 0.26
81 0.29
82 0.31
83 0.29
84 0.29
85 0.29
86 0.28
87 0.21
88 0.2
89 0.18
90 0.16
91 0.17
92 0.18
93 0.17
94 0.16
95 0.16
96 0.13
97 0.11
98 0.11
99 0.09
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.04
116 0.05
117 0.08
118 0.09
119 0.09
120 0.1
121 0.1
122 0.11
123 0.11
124 0.14
125 0.11
126 0.11
127 0.13
128 0.14
129 0.14
130 0.16
131 0.2
132 0.18
133 0.17
134 0.22
135 0.2
136 0.19
137 0.19
138 0.19
139 0.15
140 0.19
141 0.22
142 0.17
143 0.2
144 0.21
145 0.24
146 0.3
147 0.37
148 0.4
149 0.41
150 0.43
151 0.42
152 0.4
153 0.4
154 0.39
155 0.33
156 0.26
157 0.23
158 0.21
159 0.2
160 0.19
161 0.15
162 0.09
163 0.06
164 0.08
165 0.08
166 0.08
167 0.09
168 0.1
169 0.11
170 0.1
171 0.14
172 0.19
173 0.25
174 0.3
175 0.32
176 0.32
177 0.36
178 0.36
179 0.33
180 0.28
181 0.24
182 0.17
183 0.16
184 0.16
185 0.13
186 0.15
187 0.15
188 0.12
189 0.1
190 0.1
191 0.09
192 0.08
193 0.07
194 0.05
195 0.09
196 0.1
197 0.12
198 0.12
199 0.12
200 0.12
201 0.13
202 0.15
203 0.1
204 0.11
205 0.11
206 0.14
207 0.16
208 0.17
209 0.21
210 0.28
211 0.28
212 0.29
213 0.36
214 0.42
215 0.49
216 0.55
217 0.6
218 0.63
219 0.73
220 0.83
221 0.83
222 0.85
223 0.82
224 0.8
225 0.72
226 0.63
227 0.53
228 0.43
229 0.34
230 0.24
231 0.18
232 0.13
233 0.1
234 0.09
235 0.07
236 0.05
237 0.05
238 0.05
239 0.04
240 0.05
241 0.06
242 0.07
243 0.08
244 0.08
245 0.08
246 0.08
247 0.11
248 0.12
249 0.12
250 0.11
251 0.1
252 0.11
253 0.13
254 0.12
255 0.1
256 0.08
257 0.07
258 0.09
259 0.1
260 0.08
261 0.07
262 0.08
263 0.08
264 0.09
265 0.1
266 0.07
267 0.08
268 0.09
269 0.1
270 0.13
271 0.12
272 0.1
273 0.1
274 0.11
275 0.11
276 0.1
277 0.09
278 0.06
279 0.06
280 0.06
281 0.05
282 0.05
283 0.05
284 0.04
285 0.04
286 0.04
287 0.05
288 0.05
289 0.05
290 0.05
291 0.06
292 0.06
293 0.08
294 0.09
295 0.1
296 0.1
297 0.11
298 0.11
299 0.12
300 0.11
301 0.1
302 0.08
303 0.08
304 0.07
305 0.06
306 0.05
307 0.05
308 0.04
309 0.05
310 0.04
311 0.04
312 0.04
313 0.04
314 0.05
315 0.06
316 0.06
317 0.06
318 0.06
319 0.06
320 0.07
321 0.07
322 0.09
323 0.11
324 0.12
325 0.12
326 0.14
327 0.16
328 0.23
329 0.33
330 0.36
331 0.43
332 0.46
333 0.49
334 0.53
335 0.53
336 0.53
337 0.53
338 0.57
339 0.53
340 0.58
341 0.65
342 0.63
343 0.68
344 0.72
345 0.71