Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5HAK7

Protein Details
Accession U5HAK7   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
71-96SQKLEKRKQSVEGKKERKNKVKQMWDHydrophilic
NLS Segment(s)
PositionSequence
43-92EPKTKSKRVKSSTALKRLAKAKIAGMERSQKLEKRKQSVEGKKERKNKVK
Subcellular Location(s) nucl 22, cyto_nucl 12.833, mito_nucl 12.833
Family & Domain DBs
Amino Acid Sequences MGPVKNDKRSVARQEPIEQVALPEDKKEESLAVTRPHVAPAAEPKTKSKRVKSSTALKRLAKAKIAGMERSQKLEKRKQSVEGKKERKNKVKQMWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.61
3 0.55
4 0.47
5 0.37
6 0.29
7 0.26
8 0.24
9 0.19
10 0.15
11 0.15
12 0.14
13 0.14
14 0.14
15 0.11
16 0.11
17 0.14
18 0.17
19 0.18
20 0.19
21 0.2
22 0.2
23 0.2
24 0.19
25 0.16
26 0.13
27 0.19
28 0.24
29 0.24
30 0.24
31 0.29
32 0.35
33 0.44
34 0.48
35 0.47
36 0.51
37 0.54
38 0.61
39 0.62
40 0.65
41 0.66
42 0.69
43 0.69
44 0.6
45 0.6
46 0.58
47 0.54
48 0.46
49 0.39
50 0.32
51 0.32
52 0.33
53 0.3
54 0.29
55 0.35
56 0.33
57 0.36
58 0.38
59 0.37
60 0.42
61 0.5
62 0.54
63 0.55
64 0.58
65 0.62
66 0.69
67 0.75
68 0.77
69 0.78
70 0.8
71 0.8
72 0.86
73 0.87
74 0.87
75 0.87
76 0.87