Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AP02

Protein Details
Accession B2AP02   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-91TDKGKGKKGKKGKGKKGKGKAKGKAKGKBasic
NLS Segment(s)
PositionSequence
66-131KGKGKKGKKGKGKKGKGKAKGKAKGKGKAKGKGKAKGKGKAKGKGPAKPPAKGKGKAKGKGKGPKE
Subcellular Location(s) extr 14, cyto 4, E.R. 4, vacu 3
Family & Domain DBs
KEGG pan:PODANSg2491  -  
Amino Acid Sequences MHLSKFLITAIFAAPYVAALAVPVQDAYNGDIEARYAEPEALPIAAVDVDAAEVTGIDVDADVTDKGKGKKGKKGKGKKGKGKAKGKAKGKGKAKGKGKAKGKGKAKGKGPAKPPAKGKGKAKGKGKGPKEEGEAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.06
5 0.05
6 0.04
7 0.04
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.06
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.09
21 0.09
22 0.08
23 0.07
24 0.08
25 0.07
26 0.08
27 0.08
28 0.07
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.03
36 0.03
37 0.03
38 0.03
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.03
49 0.03
50 0.04
51 0.05
52 0.08
53 0.09
54 0.15
55 0.22
56 0.25
57 0.34
58 0.43
59 0.51
60 0.58
61 0.68
62 0.74
63 0.78
64 0.85
65 0.86
66 0.87
67 0.88
68 0.87
69 0.86
70 0.84
71 0.83
72 0.82
73 0.79
74 0.77
75 0.76
76 0.74
77 0.72
78 0.72
79 0.7
80 0.7
81 0.7
82 0.7
83 0.71
84 0.71
85 0.71
86 0.71
87 0.71
88 0.71
89 0.71
90 0.71
91 0.71
92 0.7
93 0.68
94 0.69
95 0.68
96 0.67
97 0.64
98 0.66
99 0.63
100 0.62
101 0.62
102 0.63
103 0.65
104 0.65
105 0.67
106 0.67
107 0.72
108 0.73
109 0.76
110 0.74
111 0.75
112 0.77
113 0.77
114 0.77
115 0.73
116 0.71
117 0.68