Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5H1N2

Protein Details
Accession U5H1N2    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
218-270MDDVRLKAKPKSKRKGKAKPKPKGGKSKHWKHKASSGGKKGEGKKKANKKPKQBasic
NLS Segment(s)
PositionSequence
149-150RK
223-270LKAKPKSKRKGKAKPKPKGGKSKHWKHKASSGGKKGEGKKKANKKPKQ
Subcellular Location(s) nucl 15, plas 6, mito 3, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPALHRRNVSSTRPSRSKDNSPSIKVNTFPFSSIPTKRFKPRHLMPSCFISLLRRYIPILRGYMHRTKLTLPRVLCLCVILLYLVLYLISQLITYGRSHHYLPLVCPPTTASKPLWERQQSHRRVIPIYETLDQSHRKKLEVRSMSRLRKLKERLSPLVAKKAPLDDGMEVEEVKQPARPVKEPKEKTREEKAAHEHGLINVQDVQLPKKVASQVNYMDDVRLKAKPKSKRKGKAKPKPKGGKSKHWKHKASSGGKKGEGKKKANKKPKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.7
4 0.73
5 0.72
6 0.75
7 0.74
8 0.72
9 0.76
10 0.72
11 0.68
12 0.6
13 0.55
14 0.49
15 0.41
16 0.36
17 0.3
18 0.3
19 0.33
20 0.36
21 0.36
22 0.39
23 0.44
24 0.53
25 0.6
26 0.61
27 0.64
28 0.67
29 0.74
30 0.75
31 0.74
32 0.67
33 0.66
34 0.61
35 0.52
36 0.43
37 0.36
38 0.31
39 0.3
40 0.28
41 0.23
42 0.23
43 0.27
44 0.3
45 0.29
46 0.28
47 0.25
48 0.28
49 0.33
50 0.38
51 0.38
52 0.35
53 0.33
54 0.36
55 0.42
56 0.43
57 0.43
58 0.36
59 0.37
60 0.37
61 0.37
62 0.33
63 0.25
64 0.19
65 0.14
66 0.13
67 0.08
68 0.07
69 0.05
70 0.05
71 0.04
72 0.04
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.05
81 0.05
82 0.08
83 0.1
84 0.12
85 0.13
86 0.15
87 0.19
88 0.19
89 0.2
90 0.26
91 0.28
92 0.25
93 0.25
94 0.24
95 0.26
96 0.26
97 0.28
98 0.19
99 0.23
100 0.27
101 0.31
102 0.38
103 0.37
104 0.4
105 0.47
106 0.57
107 0.54
108 0.56
109 0.55
110 0.48
111 0.44
112 0.41
113 0.34
114 0.28
115 0.26
116 0.23
117 0.21
118 0.19
119 0.23
120 0.27
121 0.25
122 0.27
123 0.25
124 0.24
125 0.29
126 0.33
127 0.38
128 0.41
129 0.43
130 0.47
131 0.55
132 0.58
133 0.6
134 0.6
135 0.53
136 0.54
137 0.56
138 0.54
139 0.52
140 0.55
141 0.52
142 0.52
143 0.57
144 0.51
145 0.54
146 0.47
147 0.41
148 0.35
149 0.32
150 0.28
151 0.22
152 0.21
153 0.12
154 0.12
155 0.13
156 0.12
157 0.11
158 0.1
159 0.12
160 0.11
161 0.1
162 0.11
163 0.11
164 0.15
165 0.2
166 0.24
167 0.3
168 0.41
169 0.51
170 0.56
171 0.65
172 0.69
173 0.71
174 0.72
175 0.73
176 0.71
177 0.63
178 0.64
179 0.61
180 0.58
181 0.54
182 0.49
183 0.4
184 0.33
185 0.35
186 0.27
187 0.22
188 0.16
189 0.15
190 0.16
191 0.16
192 0.17
193 0.16
194 0.17
195 0.16
196 0.19
197 0.24
198 0.26
199 0.28
200 0.32
201 0.33
202 0.35
203 0.38
204 0.34
205 0.3
206 0.28
207 0.27
208 0.24
209 0.24
210 0.24
211 0.28
212 0.36
213 0.45
214 0.54
215 0.63
216 0.71
217 0.77
218 0.85
219 0.89
220 0.93
221 0.94
222 0.94
223 0.93
224 0.94
225 0.94
226 0.92
227 0.93
228 0.9
229 0.9
230 0.9
231 0.91
232 0.9
233 0.9
234 0.87
235 0.81
236 0.82
237 0.81
238 0.8
239 0.8
240 0.78
241 0.75
242 0.75
243 0.77
244 0.78
245 0.77
246 0.76
247 0.75
248 0.76
249 0.8
250 0.84