Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2B6F2

Protein Details
Accession B2B6F2    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MASYSRQRPRRRSTNSLPMKQGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 12.833, nucl 10, cyto_nucl 6.333
Family & Domain DBs
KEGG pan:PODANSg8594  -  
Amino Acid Sequences MASYSRQRPRRRSTNSLPMKQGVSSAPSPSTDEAPNGIAGYNIVDVSWDLPVKLDDPTSEIVTVTGTIEEAIAQMEAAYPGWNETFQAGIPTDPMPTGDDTSFVSAGTADEQPESINCKVDYDGARTSKIWDGICYLRRLNTDPPKNGPGPGNCGRVSCSWKSAIYWCNDVSSPWLWVGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.84
4 0.79
5 0.71
6 0.63
7 0.54
8 0.46
9 0.37
10 0.31
11 0.26
12 0.23
13 0.21
14 0.21
15 0.23
16 0.22
17 0.24
18 0.2
19 0.19
20 0.18
21 0.18
22 0.17
23 0.14
24 0.13
25 0.1
26 0.08
27 0.08
28 0.07
29 0.06
30 0.05
31 0.05
32 0.05
33 0.06
34 0.08
35 0.07
36 0.06
37 0.07
38 0.08
39 0.08
40 0.09
41 0.09
42 0.07
43 0.09
44 0.12
45 0.12
46 0.12
47 0.11
48 0.1
49 0.1
50 0.1
51 0.08
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.03
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.06
76 0.05
77 0.07
78 0.07
79 0.07
80 0.06
81 0.07
82 0.07
83 0.07
84 0.09
85 0.08
86 0.08
87 0.09
88 0.1
89 0.1
90 0.08
91 0.08
92 0.06
93 0.06
94 0.07
95 0.07
96 0.06
97 0.06
98 0.06
99 0.07
100 0.07
101 0.12
102 0.1
103 0.13
104 0.12
105 0.13
106 0.14
107 0.18
108 0.19
109 0.19
110 0.24
111 0.23
112 0.25
113 0.24
114 0.27
115 0.25
116 0.27
117 0.23
118 0.19
119 0.21
120 0.26
121 0.29
122 0.3
123 0.28
124 0.27
125 0.29
126 0.32
127 0.38
128 0.42
129 0.47
130 0.48
131 0.53
132 0.56
133 0.55
134 0.54
135 0.51
136 0.43
137 0.43
138 0.45
139 0.44
140 0.39
141 0.38
142 0.38
143 0.37
144 0.4
145 0.35
146 0.32
147 0.3
148 0.31
149 0.32
150 0.36
151 0.37
152 0.35
153 0.37
154 0.34
155 0.34
156 0.33
157 0.31
158 0.29
159 0.25
160 0.22