Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U5H7S6

Protein Details
Accession U5H7S6    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGRVRRSRTHSNPKKNQAPGQKTRRYTHydrophilic
76-102VSLATHKTSKPHKRRLKKLQKEPYTIEHydrophilic
NLS Segment(s)
PositionSequence
84-94SKPHKRRLKKL
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0003676  F:nucleic acid binding  
GO:0043023  F:ribosomal large subunit binding  
GO:0008270  F:zinc ion binding  
GO:0000055  P:ribosomal large subunit export from nucleus  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MGRVRRSRTHSNPKKNQAPGQKTRRYTRDLDQIHNDMKDGGKAKMIDTMQHKDLEDLPGMAQHHCLSCARYFADAVSLATHKTSKPHKRRLKKLQKEPYTIEESRRAAGLGVDKGAFTKRREEAEAAQAAPTSGVATAVGAGTKEMQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.87
3 0.85
4 0.84
5 0.83
6 0.82
7 0.82
8 0.81
9 0.79
10 0.8
11 0.78
12 0.72
13 0.67
14 0.64
15 0.64
16 0.6
17 0.58
18 0.56
19 0.55
20 0.52
21 0.47
22 0.4
23 0.3
24 0.26
25 0.25
26 0.21
27 0.16
28 0.17
29 0.17
30 0.17
31 0.22
32 0.22
33 0.22
34 0.25
35 0.29
36 0.27
37 0.29
38 0.28
39 0.24
40 0.25
41 0.22
42 0.18
43 0.13
44 0.11
45 0.12
46 0.13
47 0.11
48 0.11
49 0.1
50 0.09
51 0.1
52 0.11
53 0.1
54 0.1
55 0.12
56 0.11
57 0.11
58 0.11
59 0.1
60 0.11
61 0.09
62 0.09
63 0.08
64 0.08
65 0.07
66 0.08
67 0.08
68 0.07
69 0.12
70 0.22
71 0.31
72 0.41
73 0.52
74 0.61
75 0.71
76 0.81
77 0.88
78 0.9
79 0.9
80 0.91
81 0.91
82 0.89
83 0.85
84 0.78
85 0.72
86 0.68
87 0.59
88 0.51
89 0.47
90 0.4
91 0.35
92 0.31
93 0.26
94 0.18
95 0.19
96 0.19
97 0.14
98 0.14
99 0.13
100 0.13
101 0.14
102 0.18
103 0.2
104 0.18
105 0.24
106 0.27
107 0.31
108 0.34
109 0.38
110 0.38
111 0.41
112 0.43
113 0.36
114 0.33
115 0.29
116 0.25
117 0.21
118 0.17
119 0.09
120 0.06
121 0.05
122 0.05
123 0.05
124 0.05
125 0.06
126 0.06
127 0.06
128 0.06