Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U5HJ74

Protein Details
Accession U5HJ74    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-131LAEKRPITGRKLRKERKNRAKKFRGTAKKSKSEAGBasic
NLS Segment(s)
PositionSequence
99-134EKRPITGRKLRKERKNRAKKFRGTAKKSKSEAGKKK
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDPTGAVTIRTRKFITNRLLQRKQMVVDVLHPTRANVSKDELRDKLSAMYKAPKDQVIVFGFRTQFGGGKSTGFALIYDTKESLKLEPRYRLVRFGLAEKRPITGRKLRKERKNRAKKFRGTAKKSKSEAGKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.52
4 0.6
5 0.66
6 0.71
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.31
15 0.34
16 0.3
17 0.29
18 0.27
19 0.24
20 0.26
21 0.3
22 0.27
23 0.22
24 0.26
25 0.28
26 0.32
27 0.37
28 0.34
29 0.32
30 0.31
31 0.3
32 0.29
33 0.29
34 0.27
35 0.23
36 0.29
37 0.27
38 0.29
39 0.3
40 0.26
41 0.24
42 0.23
43 0.26
44 0.21
45 0.21
46 0.18
47 0.2
48 0.19
49 0.17
50 0.18
51 0.12
52 0.12
53 0.11
54 0.12
55 0.09
56 0.09
57 0.09
58 0.09
59 0.09
60 0.07
61 0.07
62 0.07
63 0.1
64 0.1
65 0.11
66 0.11
67 0.11
68 0.12
69 0.13
70 0.13
71 0.19
72 0.24
73 0.28
74 0.33
75 0.38
76 0.43
77 0.44
78 0.46
79 0.39
80 0.38
81 0.34
82 0.36
83 0.4
84 0.35
85 0.39
86 0.35
87 0.36
88 0.34
89 0.36
90 0.35
91 0.37
92 0.44
93 0.5
94 0.61
95 0.69
96 0.76
97 0.84
98 0.9
99 0.91
100 0.93
101 0.93
102 0.93
103 0.94
104 0.92
105 0.91
106 0.91
107 0.91
108 0.89
109 0.89
110 0.87
111 0.87
112 0.81
113 0.78
114 0.77