Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U5HAT1

Protein Details
Accession U5HAT1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
58-80GLEARRWRKPRRVDTRKNEERVRBasic
NLS Segment(s)
PositionSequence
62-78RRWRKPRRVDTRKNEER
Subcellular Location(s) nucl 13.5, cyto_nucl 13, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040194  Cwf19-like  
IPR006767  Cwf19-like_C_dom-2  
Pfam View protein in Pfam  
PF04676  CwfJ_C_2  
Amino Acid Sequences MVQFDYKGEKGFGHVIEGVDDTTERDKDGDKLRDYTGGEKGEEFKRYFAHEIIGNLLGLEARRWRKPRRVDTRKNEERVRAFRKGYDAYDWTKMLTRTSEVGRAAGVVRKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.19
4 0.19
5 0.16
6 0.12
7 0.11
8 0.1
9 0.11
10 0.11
11 0.11
12 0.11
13 0.12
14 0.17
15 0.26
16 0.31
17 0.3
18 0.33
19 0.34
20 0.37
21 0.37
22 0.35
23 0.32
24 0.26
25 0.24
26 0.22
27 0.25
28 0.24
29 0.26
30 0.24
31 0.2
32 0.19
33 0.22
34 0.23
35 0.19
36 0.18
37 0.16
38 0.15
39 0.16
40 0.15
41 0.12
42 0.09
43 0.09
44 0.07
45 0.06
46 0.06
47 0.09
48 0.12
49 0.18
50 0.24
51 0.3
52 0.39
53 0.49
54 0.59
55 0.66
56 0.74
57 0.79
58 0.84
59 0.89
60 0.89
61 0.86
62 0.8
63 0.76
64 0.72
65 0.71
66 0.67
67 0.63
68 0.55
69 0.5
70 0.52
71 0.48
72 0.43
73 0.39
74 0.36
75 0.33
76 0.36
77 0.34
78 0.29
79 0.3
80 0.28
81 0.25
82 0.24
83 0.23
84 0.22
85 0.25
86 0.29
87 0.26
88 0.26
89 0.23
90 0.22
91 0.22