Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2B7M3

Protein Details
Accession B2B7M3    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-45KGVSNNPAAIKKKKKKSKSKPSDLEKNLSHydrophilic
NLS Segment(s)
PositionSequence
25-37AIKKKKKKSKSKP
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG pan:PODANSg9018  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSEDYRAAVPGTLKLKGVSNNPAAIKKKKKKSKSKPSDLEKNLSTGPPADKPTPEPTPDSEKQPQRRSPSQEPPPENGENDDNDPPKTEAERRFLEAKRKRLQELTSSGKLRPELLKTHKQRVEELNSHLSRLSEHHDMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.24
4 0.26
5 0.3
6 0.31
7 0.31
8 0.34
9 0.36
10 0.42
11 0.45
12 0.5
13 0.56
14 0.59
15 0.67
16 0.72
17 0.8
18 0.84
19 0.9
20 0.92
21 0.92
22 0.93
23 0.93
24 0.92
25 0.92
26 0.85
27 0.79
28 0.69
29 0.6
30 0.5
31 0.4
32 0.31
33 0.23
34 0.21
35 0.19
36 0.22
37 0.2
38 0.2
39 0.24
40 0.29
41 0.3
42 0.29
43 0.28
44 0.27
45 0.34
46 0.35
47 0.38
48 0.39
49 0.44
50 0.51
51 0.57
52 0.59
53 0.58
54 0.63
55 0.65
56 0.65
57 0.67
58 0.68
59 0.68
60 0.65
61 0.6
62 0.59
63 0.52
64 0.44
65 0.36
66 0.29
67 0.22
68 0.22
69 0.22
70 0.18
71 0.17
72 0.18
73 0.17
74 0.17
75 0.18
76 0.21
77 0.23
78 0.27
79 0.29
80 0.31
81 0.36
82 0.39
83 0.47
84 0.48
85 0.52
86 0.55
87 0.57
88 0.56
89 0.55
90 0.55
91 0.52
92 0.52
93 0.5
94 0.49
95 0.47
96 0.45
97 0.43
98 0.41
99 0.36
100 0.33
101 0.29
102 0.3
103 0.36
104 0.46
105 0.49
106 0.59
107 0.59
108 0.57
109 0.59
110 0.59
111 0.6
112 0.55
113 0.55
114 0.54
115 0.51
116 0.5
117 0.45
118 0.37
119 0.29
120 0.27
121 0.27
122 0.23
123 0.25
124 0.32
125 0.36
126 0.37