Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U5H1G8

Protein Details
Accession U5H1G8    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-33HTAHNQTRKAHRNGIKKPKTNKYPSLKHydrophilic
NLS Segment(s)
PositionSequence
14-42RKAHRNGIKKPKTNKYPSLKGVDPKFRRN
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTAHNQTRKAHRNGIKKPKTNKYPSLKGVDPKFRRNARHAAMGTQKAVAAAKAAAASGQYTPLGQLVEGNLSCLSPLPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.75
3 0.75
4 0.73
5 0.73
6 0.75
7 0.8
8 0.8
9 0.8
10 0.83
11 0.83
12 0.85
13 0.82
14 0.81
15 0.79
16 0.77
17 0.74
18 0.71
19 0.64
20 0.61
21 0.59
22 0.6
23 0.55
24 0.53
25 0.56
26 0.55
27 0.56
28 0.54
29 0.55
30 0.47
31 0.51
32 0.45
33 0.41
34 0.42
35 0.39
36 0.35
37 0.28
38 0.25
39 0.18
40 0.17
41 0.13
42 0.08
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.06
50 0.05
51 0.07
52 0.06
53 0.06
54 0.07
55 0.08
56 0.08
57 0.07
58 0.08
59 0.08
60 0.12
61 0.12
62 0.14
63 0.13
64 0.12
65 0.13