Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5H9U0

Protein Details
Accession U5H9U0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
387-411FTPVKMAQTLRKRRPRRGEDPTVFAHydrophilic
NLS Segment(s)
PositionSequence
379-382KKRA
397-403RKRRPRR
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007133  RNA_pol_II-assoc_Paf1  
Gene Ontology GO:0016593  C:Cdc73/Paf1 complex  
GO:0016570  P:histone modification  
GO:0006368  P:transcription elongation by RNA polymerase II  
Pfam View protein in Pfam  
PF03985  Paf1  
Amino Acid Sequences MASRNSKTDLIVRVRYQQKLPPPPFPPRLLHIPTSPHRYAEAGALNALASEREVPMILDGELGLPLEMGKIPDGAYGDGEEEYWIGNRSAIVPTGPAPTPHEDDLFLLGDVAAAGPSSASSSFVATPGHIPPGGGTPAMGERRKVDVSWLRRTEYLSSDPGSKVLTDKQAPSAHKTDEPLLDSLSRDARAKTIAATFTAAHIPLSELRHPSKAHLRAEEAWDVLPDAELWPNQLNLVRFGEDPGERAEKEGTNGVGTGGGHGFLDPRLPRALFRPVELPADDNRVGYYLPVSDQVAQAYTKKRERVLDDDDEGEGGADEEEGFEFVHVRDYEITTTRNLVGEYVFVVHDGLGKEPDQGGETVTSTGEKEEEVGSAGGGKKRARGAYFTPVKMAQTLRKRRPRRGEDPTVFAHDPDRSEEDQLVFWDKIQVKVTPIDEVLPEAEKEDREKELRTVLEPPRRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.58
4 0.56
5 0.59
6 0.63
7 0.65
8 0.65
9 0.64
10 0.69
11 0.71
12 0.7
13 0.64
14 0.59
15 0.63
16 0.59
17 0.57
18 0.52
19 0.53
20 0.55
21 0.59
22 0.54
23 0.46
24 0.42
25 0.4
26 0.36
27 0.34
28 0.31
29 0.23
30 0.22
31 0.21
32 0.19
33 0.17
34 0.16
35 0.1
36 0.06
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.09
43 0.1
44 0.09
45 0.08
46 0.08
47 0.08
48 0.08
49 0.07
50 0.06
51 0.05
52 0.05
53 0.05
54 0.06
55 0.06
56 0.07
57 0.07
58 0.08
59 0.09
60 0.11
61 0.1
62 0.1
63 0.1
64 0.11
65 0.1
66 0.1
67 0.09
68 0.07
69 0.07
70 0.08
71 0.09
72 0.08
73 0.08
74 0.08
75 0.1
76 0.11
77 0.12
78 0.11
79 0.1
80 0.12
81 0.15
82 0.16
83 0.15
84 0.18
85 0.22
86 0.25
87 0.26
88 0.25
89 0.22
90 0.22
91 0.23
92 0.2
93 0.15
94 0.11
95 0.1
96 0.08
97 0.08
98 0.07
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.04
105 0.04
106 0.06
107 0.07
108 0.09
109 0.09
110 0.1
111 0.11
112 0.1
113 0.13
114 0.12
115 0.14
116 0.12
117 0.12
118 0.11
119 0.14
120 0.15
121 0.12
122 0.11
123 0.1
124 0.15
125 0.21
126 0.21
127 0.18
128 0.2
129 0.24
130 0.25
131 0.24
132 0.27
133 0.29
134 0.35
135 0.44
136 0.45
137 0.42
138 0.43
139 0.45
140 0.4
141 0.36
142 0.33
143 0.26
144 0.24
145 0.25
146 0.24
147 0.22
148 0.2
149 0.16
150 0.14
151 0.15
152 0.19
153 0.19
154 0.2
155 0.25
156 0.3
157 0.32
158 0.35
159 0.35
160 0.32
161 0.31
162 0.32
163 0.29
164 0.26
165 0.26
166 0.22
167 0.19
168 0.17
169 0.16
170 0.16
171 0.15
172 0.13
173 0.13
174 0.12
175 0.12
176 0.13
177 0.13
178 0.13
179 0.13
180 0.13
181 0.12
182 0.13
183 0.12
184 0.12
185 0.13
186 0.11
187 0.08
188 0.08
189 0.08
190 0.1
191 0.13
192 0.14
193 0.16
194 0.18
195 0.22
196 0.22
197 0.24
198 0.3
199 0.34
200 0.34
201 0.33
202 0.35
203 0.33
204 0.36
205 0.34
206 0.26
207 0.19
208 0.16
209 0.14
210 0.11
211 0.09
212 0.05
213 0.05
214 0.05
215 0.05
216 0.06
217 0.07
218 0.07
219 0.07
220 0.1
221 0.09
222 0.11
223 0.12
224 0.12
225 0.11
226 0.12
227 0.14
228 0.12
229 0.12
230 0.12
231 0.14
232 0.12
233 0.13
234 0.15
235 0.12
236 0.13
237 0.14
238 0.12
239 0.1
240 0.1
241 0.09
242 0.08
243 0.08
244 0.07
245 0.06
246 0.06
247 0.05
248 0.05
249 0.05
250 0.04
251 0.09
252 0.08
253 0.1
254 0.11
255 0.12
256 0.13
257 0.16
258 0.24
259 0.21
260 0.22
261 0.23
262 0.23
263 0.25
264 0.24
265 0.23
266 0.16
267 0.21
268 0.2
269 0.17
270 0.16
271 0.14
272 0.14
273 0.12
274 0.11
275 0.06
276 0.06
277 0.08
278 0.08
279 0.09
280 0.1
281 0.1
282 0.1
283 0.1
284 0.14
285 0.18
286 0.24
287 0.28
288 0.3
289 0.34
290 0.38
291 0.42
292 0.45
293 0.46
294 0.45
295 0.42
296 0.4
297 0.36
298 0.31
299 0.26
300 0.19
301 0.12
302 0.07
303 0.05
304 0.03
305 0.03
306 0.03
307 0.04
308 0.04
309 0.04
310 0.04
311 0.05
312 0.05
313 0.11
314 0.11
315 0.12
316 0.13
317 0.14
318 0.17
319 0.18
320 0.2
321 0.15
322 0.17
323 0.17
324 0.16
325 0.15
326 0.13
327 0.11
328 0.1
329 0.1
330 0.09
331 0.08
332 0.07
333 0.07
334 0.07
335 0.09
336 0.1
337 0.1
338 0.1
339 0.11
340 0.12
341 0.12
342 0.13
343 0.11
344 0.11
345 0.11
346 0.1
347 0.11
348 0.1
349 0.1
350 0.1
351 0.09
352 0.09
353 0.09
354 0.07
355 0.08
356 0.08
357 0.08
358 0.09
359 0.09
360 0.08
361 0.11
362 0.14
363 0.15
364 0.19
365 0.2
366 0.23
367 0.28
368 0.33
369 0.32
370 0.34
371 0.37
372 0.44
373 0.51
374 0.47
375 0.46
376 0.42
377 0.41
378 0.39
379 0.38
380 0.36
381 0.38
382 0.49
383 0.55
384 0.65
385 0.72
386 0.79
387 0.87
388 0.88
389 0.88
390 0.87
391 0.88
392 0.83
393 0.8
394 0.73
395 0.7
396 0.6
397 0.5
398 0.44
399 0.35
400 0.31
401 0.3
402 0.32
403 0.26
404 0.28
405 0.3
406 0.28
407 0.27
408 0.27
409 0.27
410 0.21
411 0.2
412 0.26
413 0.25
414 0.28
415 0.3
416 0.3
417 0.28
418 0.33
419 0.34
420 0.29
421 0.28
422 0.25
423 0.23
424 0.23
425 0.21
426 0.18
427 0.17
428 0.15
429 0.17
430 0.17
431 0.21
432 0.22
433 0.26
434 0.28
435 0.31
436 0.32
437 0.37
438 0.37
439 0.36
440 0.42
441 0.45