Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5H7D4

Protein Details
Accession U5H7D4   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
269-293IGTTPLPRPSKKRCKVSPRCCATSEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences HRRCRRFSPAFSLPQTQAIHRLLPHCVEKGLHVILAFDDVPLSPSTMSLSLQSLPAELLYAIHLHSTSSALPYVSRHLHRVFSHSSPLHRTTYLALRHDRHTLSHAVRYPICTLAVVHSLERLACAVGMRPLRCSELPRRLVKHLNPQQTDSSATLDDDKFGLIAYLLEHYGASPNSKNGYFLARAVLARHLPLTKLLLHYGADPALKDGWAVMVAIGMGDLDTVKLLLDGPTPTVGRVEASGRDKSSSSHTRSDTLPPQAAFLARHSIGTTPLPRPSKKRCKVSPRCCATSEMLEAAVKAQHWHIVDYLRTQGALPSLEVLKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.54
3 0.46
4 0.44
5 0.38
6 0.36
7 0.33
8 0.34
9 0.3
10 0.33
11 0.36
12 0.3
13 0.29
14 0.27
15 0.26
16 0.28
17 0.26
18 0.22
19 0.18
20 0.17
21 0.15
22 0.17
23 0.15
24 0.1
25 0.09
26 0.08
27 0.1
28 0.1
29 0.11
30 0.08
31 0.08
32 0.1
33 0.11
34 0.11
35 0.11
36 0.13
37 0.12
38 0.14
39 0.14
40 0.12
41 0.11
42 0.1
43 0.09
44 0.07
45 0.07
46 0.06
47 0.07
48 0.06
49 0.07
50 0.07
51 0.06
52 0.07
53 0.08
54 0.08
55 0.09
56 0.1
57 0.09
58 0.1
59 0.11
60 0.16
61 0.21
62 0.22
63 0.26
64 0.27
65 0.33
66 0.33
67 0.38
68 0.37
69 0.33
70 0.4
71 0.37
72 0.38
73 0.38
74 0.41
75 0.38
76 0.33
77 0.32
78 0.27
79 0.32
80 0.33
81 0.32
82 0.35
83 0.35
84 0.37
85 0.41
86 0.39
87 0.33
88 0.31
89 0.33
90 0.29
91 0.32
92 0.33
93 0.32
94 0.32
95 0.33
96 0.31
97 0.26
98 0.23
99 0.18
100 0.14
101 0.13
102 0.16
103 0.14
104 0.12
105 0.12
106 0.12
107 0.11
108 0.11
109 0.09
110 0.05
111 0.05
112 0.05
113 0.05
114 0.1
115 0.13
116 0.13
117 0.15
118 0.16
119 0.19
120 0.2
121 0.24
122 0.27
123 0.33
124 0.4
125 0.43
126 0.46
127 0.47
128 0.53
129 0.52
130 0.55
131 0.54
132 0.56
133 0.52
134 0.51
135 0.48
136 0.42
137 0.4
138 0.3
139 0.24
140 0.15
141 0.14
142 0.14
143 0.12
144 0.11
145 0.09
146 0.08
147 0.07
148 0.06
149 0.06
150 0.03
151 0.03
152 0.03
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.06
159 0.06
160 0.07
161 0.07
162 0.09
163 0.11
164 0.11
165 0.12
166 0.11
167 0.14
168 0.13
169 0.13
170 0.13
171 0.13
172 0.13
173 0.13
174 0.15
175 0.12
176 0.11
177 0.12
178 0.11
179 0.1
180 0.11
181 0.12
182 0.11
183 0.12
184 0.12
185 0.12
186 0.12
187 0.12
188 0.12
189 0.12
190 0.1
191 0.09
192 0.09
193 0.09
194 0.08
195 0.07
196 0.06
197 0.05
198 0.05
199 0.05
200 0.04
201 0.04
202 0.03
203 0.03
204 0.03
205 0.03
206 0.02
207 0.02
208 0.02
209 0.02
210 0.02
211 0.03
212 0.03
213 0.03
214 0.04
215 0.04
216 0.06
217 0.07
218 0.08
219 0.1
220 0.11
221 0.11
222 0.11
223 0.1
224 0.09
225 0.1
226 0.11
227 0.15
228 0.19
229 0.22
230 0.22
231 0.23
232 0.23
233 0.23
234 0.3
235 0.33
236 0.34
237 0.38
238 0.39
239 0.4
240 0.42
241 0.48
242 0.46
243 0.43
244 0.43
245 0.36
246 0.35
247 0.34
248 0.33
249 0.27
250 0.23
251 0.23
252 0.19
253 0.19
254 0.18
255 0.18
256 0.19
257 0.23
258 0.25
259 0.22
260 0.3
261 0.36
262 0.4
263 0.48
264 0.56
265 0.62
266 0.67
267 0.75
268 0.77
269 0.82
270 0.89
271 0.92
272 0.91
273 0.89
274 0.84
275 0.76
276 0.7
277 0.63
278 0.57
279 0.49
280 0.4
281 0.32
282 0.27
283 0.25
284 0.22
285 0.19
286 0.14
287 0.12
288 0.12
289 0.15
290 0.16
291 0.17
292 0.18
293 0.21
294 0.23
295 0.25
296 0.28
297 0.24
298 0.24
299 0.22
300 0.22
301 0.21
302 0.2
303 0.17
304 0.16
305 0.17