Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5H3I5

Protein Details
Accession U5H3I5   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-30DSSAGKPQKKSKNSSHKKATTKPGRSHydrophilic
NLS Segment(s)
PositionSequence
10-25KPQKKSKNSSHKKATT
Subcellular Location(s) nucl 22.5, mito_nucl 13.833, cyto_nucl 12.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MPRHDSSAGKPQKKSKNSSHKKATTKPGRSSNFNAFLNMKLAELKKSEPTLSHAERLKQINDLWKIETGKKKQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.74
4 0.78
5 0.83
6 0.84
7 0.82
8 0.83
9 0.83
10 0.83
11 0.82
12 0.8
13 0.77
14 0.76
15 0.72
16 0.69
17 0.66
18 0.63
19 0.59
20 0.51
21 0.45
22 0.36
23 0.33
24 0.29
25 0.24
26 0.16
27 0.12
28 0.13
29 0.13
30 0.13
31 0.14
32 0.16
33 0.18
34 0.18
35 0.17
36 0.21
37 0.27
38 0.28
39 0.32
40 0.32
41 0.33
42 0.38
43 0.41
44 0.37
45 0.33
46 0.33
47 0.36
48 0.37
49 0.37
50 0.33
51 0.35
52 0.38
53 0.42
54 0.49