Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5HES0

Protein Details
Accession U5HES0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-103ATQNWWDKHNKPKQWKDIRAQYDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, E.R. 3, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MDPSILTFSLVGALAALAAFRTHPRLARLSHTSVPAPAPAQHPQTAMAITSSLTRVFSRNSVFVGTVFFGAFAFSMGFDVATQNWWDKHNKPKQWKDIRAQYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.03
5 0.03
6 0.04
7 0.05
8 0.1
9 0.12
10 0.14
11 0.18
12 0.22
13 0.24
14 0.3
15 0.35
16 0.36
17 0.37
18 0.37
19 0.34
20 0.31
21 0.3
22 0.24
23 0.2
24 0.17
25 0.17
26 0.18
27 0.21
28 0.21
29 0.21
30 0.21
31 0.2
32 0.18
33 0.15
34 0.11
35 0.08
36 0.07
37 0.07
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.09
44 0.12
45 0.13
46 0.13
47 0.14
48 0.14
49 0.14
50 0.13
51 0.13
52 0.11
53 0.09
54 0.08
55 0.07
56 0.06
57 0.06
58 0.06
59 0.05
60 0.04
61 0.04
62 0.05
63 0.04
64 0.05
65 0.05
66 0.06
67 0.05
68 0.07
69 0.08
70 0.11
71 0.12
72 0.15
73 0.21
74 0.25
75 0.36
76 0.45
77 0.53
78 0.62
79 0.7
80 0.79
81 0.85
82 0.88
83 0.88