Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5H8T9

Protein Details
Accession U5H8T9    Localization Confidence Low Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-119MNYSGMKKLRRRRVSVRALLGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 4, plas 3, golg 2, nucl 1, cyto 1, cyto_nucl 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MRCSMSLCLSFLLFHTALAIAAPVPLRQVRDVGPSNELEQPNKTPSVDPKRATLSSSQLSASEDSPSASDDAENSQAKHHHSKLCKKKSMDTNGWSGGMNYSGMKKLRRRRVSVRALLGVKPPDSLTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.12
5 0.11
6 0.11
7 0.05
8 0.06
9 0.07
10 0.06
11 0.08
12 0.1
13 0.12
14 0.13
15 0.15
16 0.15
17 0.22
18 0.25
19 0.25
20 0.26
21 0.25
22 0.26
23 0.3
24 0.3
25 0.25
26 0.23
27 0.24
28 0.24
29 0.25
30 0.23
31 0.19
32 0.27
33 0.35
34 0.4
35 0.38
36 0.39
37 0.43
38 0.42
39 0.42
40 0.35
41 0.3
42 0.24
43 0.24
44 0.21
45 0.16
46 0.17
47 0.16
48 0.14
49 0.1
50 0.09
51 0.08
52 0.08
53 0.08
54 0.07
55 0.06
56 0.06
57 0.05
58 0.07
59 0.11
60 0.12
61 0.12
62 0.13
63 0.16
64 0.19
65 0.25
66 0.28
67 0.3
68 0.37
69 0.47
70 0.56
71 0.64
72 0.68
73 0.65
74 0.69
75 0.73
76 0.74
77 0.72
78 0.64
79 0.6
80 0.54
81 0.52
82 0.44
83 0.34
84 0.25
85 0.18
86 0.15
87 0.1
88 0.1
89 0.14
90 0.17
91 0.23
92 0.31
93 0.41
94 0.51
95 0.59
96 0.65
97 0.71
98 0.78
99 0.83
100 0.83
101 0.79
102 0.76
103 0.7
104 0.64
105 0.6
106 0.53
107 0.43
108 0.36