Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5GY11

Protein Details
Accession U5GY11    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
135-156QMEARRTKNKAARERRAGRIAEHydrophilic
NLS Segment(s)
PositionSequence
31-81RARARDHEAAKAKGRHTGAGKRKGSADARMPTKVLWMRRQRVLRRMLRKYR
138-158ARRTKNKAARERRAGRIAEKR
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035970  60S_ribosomal_L19/L19e_sf  
IPR000196  Ribosomal_L19/L19e  
IPR039547  RPL19  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01280  Ribosomal_L19e  
Amino Acid Sequences MEQGAGRKQGIIKSLRKDGYIIVKPQVIHSRARARDHEAAKAKGRHTGAGKRKGSADARMPTKVLWMRRQRVLRRMLRKYREDGKINKHLYHELYLKAKGNVFKARQLRHNKRVLMDHIHKAKAEQSRTKILADQMEARRTKNKAARERRAGRIAEKRSAIAAIETEAEIKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.47
4 0.45
5 0.43
6 0.46
7 0.45
8 0.41
9 0.36
10 0.37
11 0.36
12 0.4
13 0.44
14 0.36
15 0.33
16 0.37
17 0.44
18 0.47
19 0.52
20 0.5
21 0.49
22 0.55
23 0.54
24 0.55
25 0.52
26 0.51
27 0.53
28 0.54
29 0.48
30 0.46
31 0.45
32 0.4
33 0.4
34 0.45
35 0.47
36 0.52
37 0.53
38 0.48
39 0.49
40 0.5
41 0.47
42 0.42
43 0.41
44 0.37
45 0.39
46 0.38
47 0.37
48 0.31
49 0.35
50 0.33
51 0.3
52 0.33
53 0.39
54 0.42
55 0.49
56 0.57
57 0.56
58 0.6
59 0.65
60 0.64
61 0.65
62 0.7
63 0.72
64 0.71
65 0.69
66 0.67
67 0.66
68 0.64
69 0.6
70 0.57
71 0.55
72 0.57
73 0.56
74 0.52
75 0.46
76 0.41
77 0.37
78 0.34
79 0.29
80 0.22
81 0.22
82 0.23
83 0.23
84 0.22
85 0.23
86 0.21
87 0.24
88 0.28
89 0.27
90 0.31
91 0.37
92 0.39
93 0.45
94 0.54
95 0.59
96 0.61
97 0.67
98 0.63
99 0.59
100 0.61
101 0.57
102 0.55
103 0.51
104 0.5
105 0.47
106 0.46
107 0.43
108 0.38
109 0.4
110 0.38
111 0.39
112 0.38
113 0.38
114 0.44
115 0.45
116 0.46
117 0.43
118 0.39
119 0.36
120 0.32
121 0.35
122 0.32
123 0.38
124 0.38
125 0.38
126 0.41
127 0.4
128 0.46
129 0.44
130 0.49
131 0.53
132 0.63
133 0.71
134 0.75
135 0.8
136 0.8
137 0.81
138 0.74
139 0.72
140 0.71
141 0.67
142 0.63
143 0.58
144 0.51
145 0.44
146 0.42
147 0.34
148 0.25
149 0.2
150 0.14
151 0.13
152 0.13