Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AR79

Protein Details
Accession B2AR79    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
208-237DCTKSHDQKAEEKRRRRRQRDDSRTRAMQSBasic
NLS Segment(s)
PositionSequence
219-226EKRRRRRQ
Subcellular Location(s) plas 9, cyto 7, mito 4, pero 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008217  Ccc1_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0005384  F:manganese ion transmembrane transporter activity  
GO:0030026  P:intracellular manganese ion homeostasis  
KEGG pan:PODANSg3019  -  
Pfam View protein in Pfam  
PF01988  VIT1  
Amino Acid Sequences MFAVPIEEFRKIRENRRKLATSTKSSTPPPPPSLDNVSTDIELQLPAPAIIDDAQGPDAHKPLINPRLISDATIGLSDGLTVPFALTAGLTALGDTRTVIYGGLAELIAGAISMGLGGYLGARGELAAYEESHSRLMTLLQEPGPPTKSAITAGQDAVIEALQQALFPLQVHRLDLKHQLIEGESEEWVGLLLRLQGISLPSTCTDDDCTKSHDQKAEEKRRRRRQRDDSRTRAMQSAVTIAAGYFLGGLLPLIPYFFVAGHIGKLMTGLYISIGVMGVALFTFGYVKTAVVVGFGRQHAKKSVLGGVQMVIVGGMAAGAAMGLVKVFEGVGTFGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.73
4 0.75
5 0.7
6 0.76
7 0.74
8 0.72
9 0.69
10 0.66
11 0.62
12 0.61
13 0.64
14 0.62
15 0.61
16 0.56
17 0.55
18 0.52
19 0.53
20 0.56
21 0.51
22 0.46
23 0.41
24 0.38
25 0.34
26 0.32
27 0.26
28 0.19
29 0.16
30 0.13
31 0.1
32 0.09
33 0.08
34 0.08
35 0.07
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.09
42 0.09
43 0.11
44 0.11
45 0.12
46 0.12
47 0.13
48 0.13
49 0.22
50 0.28
51 0.31
52 0.29
53 0.29
54 0.34
55 0.33
56 0.32
57 0.25
58 0.19
59 0.16
60 0.16
61 0.14
62 0.09
63 0.08
64 0.08
65 0.07
66 0.05
67 0.05
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.03
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.05
88 0.05
89 0.05
90 0.06
91 0.05
92 0.04
93 0.04
94 0.04
95 0.03
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.01
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.03
112 0.03
113 0.04
114 0.05
115 0.05
116 0.07
117 0.07
118 0.09
119 0.09
120 0.09
121 0.08
122 0.07
123 0.08
124 0.09
125 0.1
126 0.11
127 0.11
128 0.13
129 0.14
130 0.16
131 0.17
132 0.14
133 0.14
134 0.13
135 0.13
136 0.13
137 0.14
138 0.14
139 0.14
140 0.14
141 0.13
142 0.12
143 0.11
144 0.1
145 0.08
146 0.05
147 0.04
148 0.04
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.04
155 0.05
156 0.07
157 0.07
158 0.08
159 0.1
160 0.11
161 0.13
162 0.19
163 0.2
164 0.17
165 0.17
166 0.17
167 0.15
168 0.16
169 0.14
170 0.09
171 0.07
172 0.07
173 0.07
174 0.06
175 0.06
176 0.05
177 0.04
178 0.03
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.05
185 0.06
186 0.06
187 0.07
188 0.07
189 0.1
190 0.1
191 0.1
192 0.13
193 0.15
194 0.17
195 0.18
196 0.22
197 0.25
198 0.29
199 0.32
200 0.34
201 0.34
202 0.4
203 0.5
204 0.56
205 0.61
206 0.67
207 0.74
208 0.81
209 0.89
210 0.9
211 0.9
212 0.9
213 0.92
214 0.94
215 0.93
216 0.91
217 0.88
218 0.82
219 0.73
220 0.64
221 0.53
222 0.43
223 0.33
224 0.26
225 0.18
226 0.14
227 0.12
228 0.09
229 0.09
230 0.07
231 0.06
232 0.04
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.04
242 0.04
243 0.05
244 0.05
245 0.06
246 0.08
247 0.09
248 0.09
249 0.1
250 0.09
251 0.09
252 0.09
253 0.07
254 0.05
255 0.05
256 0.05
257 0.04
258 0.05
259 0.05
260 0.04
261 0.04
262 0.04
263 0.04
264 0.04
265 0.03
266 0.03
267 0.03
268 0.03
269 0.03
270 0.04
271 0.04
272 0.06
273 0.06
274 0.06
275 0.07
276 0.08
277 0.08
278 0.09
279 0.09
280 0.1
281 0.14
282 0.16
283 0.22
284 0.22
285 0.26
286 0.28
287 0.31
288 0.32
289 0.31
290 0.36
291 0.32
292 0.32
293 0.3
294 0.26
295 0.23
296 0.2
297 0.17
298 0.1
299 0.07
300 0.05
301 0.04
302 0.03
303 0.02
304 0.02
305 0.02
306 0.02
307 0.02
308 0.02
309 0.02
310 0.02
311 0.02
312 0.03
313 0.03
314 0.03
315 0.03
316 0.04