Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U5HF79

Protein Details
Accession U5HF79    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-75NLKLDKDRKNLLKRKDRKAGETKEBasic
NLS Segment(s)
PositionSequence
61-69NLLKRKDRK
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF16906  Ribosomal_L26  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MIVRRTDKGREGKVAQVYHKKWVIHVNGVHREKGSGETVPIGVNPSKCVITNLKLDKDRKNLLKRKDRKAGETKEEDVEMKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.56
4 0.53
5 0.52
6 0.54
7 0.47
8 0.42
9 0.46
10 0.43
11 0.39
12 0.41
13 0.42
14 0.47
15 0.49
16 0.47
17 0.39
18 0.36
19 0.3
20 0.28
21 0.22
22 0.13
23 0.11
24 0.11
25 0.11
26 0.11
27 0.1
28 0.09
29 0.09
30 0.09
31 0.09
32 0.1
33 0.1
34 0.1
35 0.13
36 0.14
37 0.16
38 0.24
39 0.28
40 0.32
41 0.38
42 0.42
43 0.46
44 0.5
45 0.54
46 0.56
47 0.62
48 0.64
49 0.68
50 0.75
51 0.78
52 0.81
53 0.83
54 0.79
55 0.78
56 0.8
57 0.79
58 0.77
59 0.75
60 0.68
61 0.61
62 0.58