Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U5GZW1

Protein Details
Accession U5GZW1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
42-64GLPTPDAKQKKKKTKSSTSLSLKHydrophilic
NLS Segment(s)
PositionSequence
48-55AKQKKKKT
Subcellular Location(s) nucl 17.5, mito_nucl 12.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MDNEGHKDGVRATNSARAALVAKLSSSSAYTKTPGSLKLKGGLPTPDAKQKKKKTKSSTSLSLKDSDTHPESSSASTSSSPHHPGSTKTEAQKRFEQVQKKRLLEKAAKAATKTHKERVAEFNEKLENMSEHYDIPRVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.26
4 0.2
5 0.2
6 0.19
7 0.19
8 0.12
9 0.11
10 0.11
11 0.12
12 0.11
13 0.11
14 0.12
15 0.12
16 0.14
17 0.15
18 0.15
19 0.18
20 0.19
21 0.24
22 0.28
23 0.3
24 0.3
25 0.33
26 0.36
27 0.35
28 0.36
29 0.31
30 0.28
31 0.28
32 0.28
33 0.33
34 0.35
35 0.4
36 0.47
37 0.56
38 0.64
39 0.71
40 0.78
41 0.78
42 0.83
43 0.85
44 0.82
45 0.82
46 0.79
47 0.74
48 0.65
49 0.58
50 0.48
51 0.41
52 0.34
53 0.29
54 0.24
55 0.2
56 0.19
57 0.17
58 0.17
59 0.16
60 0.16
61 0.12
62 0.1
63 0.1
64 0.1
65 0.11
66 0.14
67 0.17
68 0.17
69 0.18
70 0.18
71 0.2
72 0.27
73 0.31
74 0.32
75 0.34
76 0.42
77 0.44
78 0.48
79 0.51
80 0.48
81 0.49
82 0.51
83 0.55
84 0.55
85 0.6
86 0.64
87 0.62
88 0.63
89 0.59
90 0.61
91 0.57
92 0.55
93 0.56
94 0.53
95 0.51
96 0.47
97 0.5
98 0.51
99 0.55
100 0.54
101 0.52
102 0.51
103 0.52
104 0.56
105 0.57
106 0.57
107 0.55
108 0.51
109 0.48
110 0.46
111 0.44
112 0.4
113 0.34
114 0.26
115 0.21
116 0.24
117 0.2
118 0.18
119 0.2
120 0.22
121 0.2