Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U5GYH7

Protein Details
Accession U5GYH7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-93GLVEDSKKRRRKAKQARRRHKKGRKATNPSTSSGBasic
NLS Segment(s)
PositionSequence
66-85KKRRRKAKQARRRHKKGRKA
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MSAKQGRWAHAIASGQSATTSTGDSDGSKGAGALAQVYRMFTMSGVLEDLVREVDGGGPGLVEDSKKRRRKAKQARRRHKKGRKATNPSTSSGTSQKSIETASDAMSIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.16
4 0.16
5 0.13
6 0.11
7 0.11
8 0.08
9 0.09
10 0.09
11 0.1
12 0.1
13 0.09
14 0.09
15 0.08
16 0.08
17 0.07
18 0.07
19 0.06
20 0.07
21 0.06
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.08
28 0.06
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.03
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.04
50 0.06
51 0.14
52 0.24
53 0.31
54 0.37
55 0.46
56 0.56
57 0.67
58 0.76
59 0.8
60 0.81
61 0.86
62 0.92
63 0.94
64 0.95
65 0.95
66 0.94
67 0.93
68 0.93
69 0.93
70 0.93
71 0.91
72 0.9
73 0.89
74 0.82
75 0.74
76 0.68
77 0.59
78 0.52
79 0.47
80 0.41
81 0.33
82 0.3
83 0.28
84 0.24
85 0.23
86 0.2
87 0.18
88 0.16
89 0.15