Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5H732

Protein Details
Accession U5H732    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
162-181ERLEGKGKVKKEKGKGKGIKBasic
NLS Segment(s)
PositionSequence
151-181ERKKREEMEEKERLEGKGKVKKEKGKGKGIK
Subcellular Location(s) nucl 11, cyto_nucl 10.5, cyto 8, cysk 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036603  RBP11-like  
IPR009025  RBP11-like_dimer  
IPR008193  RNA_pol_Rpb11_13-16kDa_CS  
IPR033898  RNAP_AC19  
Gene Ontology GO:0055029  C:nuclear DNA-directed RNA polymerase complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF13656  RNA_pol_L_2  
PROSITE View protein in PROSITE  
PS01154  RNA_POL_L_13KD  
CDD cd07029  RNAP_I_III_AC19  
Amino Acid Sequences MSDSAAAAPIAMDEDGSVRSDKIYALPGFTEGYTAVTYCINDEDHTLGNLLRWMLMKNPDVEFCGYSAPHPSEAKIHLRIQMYDQKSSLTALHTALDNLEQMTESILSAYAASLASGDFERSVEPSYDFESVNDRLWAEKEARGISREEFERKKREEMEEKERLEGKGKVKKEKGKGKGIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.09
4 0.09
5 0.08
6 0.09
7 0.1
8 0.1
9 0.11
10 0.17
11 0.16
12 0.17
13 0.17
14 0.18
15 0.19
16 0.18
17 0.17
18 0.1
19 0.11
20 0.1
21 0.1
22 0.09
23 0.09
24 0.09
25 0.09
26 0.1
27 0.09
28 0.09
29 0.11
30 0.12
31 0.12
32 0.12
33 0.12
34 0.11
35 0.1
36 0.11
37 0.1
38 0.09
39 0.09
40 0.09
41 0.11
42 0.16
43 0.18
44 0.19
45 0.2
46 0.2
47 0.21
48 0.21
49 0.19
50 0.14
51 0.14
52 0.11
53 0.11
54 0.14
55 0.13
56 0.15
57 0.15
58 0.15
59 0.16
60 0.2
61 0.24
62 0.24
63 0.25
64 0.26
65 0.27
66 0.27
67 0.28
68 0.32
69 0.3
70 0.27
71 0.25
72 0.21
73 0.2
74 0.21
75 0.17
76 0.11
77 0.09
78 0.08
79 0.09
80 0.08
81 0.08
82 0.07
83 0.07
84 0.06
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.03
102 0.04
103 0.04
104 0.05
105 0.05
106 0.05
107 0.06
108 0.07
109 0.08
110 0.08
111 0.09
112 0.11
113 0.13
114 0.15
115 0.14
116 0.14
117 0.17
118 0.18
119 0.18
120 0.17
121 0.15
122 0.14
123 0.15
124 0.17
125 0.15
126 0.16
127 0.18
128 0.2
129 0.22
130 0.22
131 0.23
132 0.23
133 0.26
134 0.28
135 0.32
136 0.36
137 0.42
138 0.5
139 0.52
140 0.57
141 0.57
142 0.61
143 0.64
144 0.65
145 0.67
146 0.67
147 0.65
148 0.63
149 0.61
150 0.53
151 0.48
152 0.46
153 0.45
154 0.45
155 0.5
156 0.55
157 0.61
158 0.69
159 0.74
160 0.78
161 0.78