Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5HAS5

Protein Details
Accession U5HAS5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
204-225GTRPTPCNTSRRRTSRRSTSLAHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 22, cyto_nucl 2.5, mito 2, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036412  HAD-like_sf  
IPR006379  HAD-SF_hydro_IIB  
IPR005002  PMM  
IPR043169  PMM_cap  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0004615  F:phosphomannomutase activity  
GO:0009298  P:GDP-mannose biosynthetic process  
Pfam View protein in Pfam  
PF03332  PMM  
CDD cd02585  HAD_PMM  
Amino Acid Sequences MSPVTPFSERPQGDVVCLFDVDGTLTPARRTASPEILEVLKQVRAKAVIGFVGGSDLPKITEQLAVHGQNITDDFDFCFAENGLTAIKLGQELDSASFIKFIGEEKYKKMVRFILHYIADLDIPIKRGTFIEFRNGMINVSPIGRNASVQERDEFEKYDKESKVRATFVEALKKEFADYGLTYSIGGQISFDVLYALKRSPMAGTRPTPCNTSRRRTSRRSTSLATRPTKEATTTRFTRTRGRSGMPYRAPPIRSASSRLCSSFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.23
4 0.23
5 0.19
6 0.13
7 0.13
8 0.12
9 0.1
10 0.11
11 0.11
12 0.13
13 0.13
14 0.16
15 0.17
16 0.17
17 0.23
18 0.26
19 0.32
20 0.32
21 0.33
22 0.33
23 0.33
24 0.31
25 0.27
26 0.23
27 0.2
28 0.19
29 0.19
30 0.18
31 0.19
32 0.19
33 0.19
34 0.19
35 0.15
36 0.14
37 0.14
38 0.11
39 0.11
40 0.1
41 0.09
42 0.07
43 0.07
44 0.07
45 0.08
46 0.09
47 0.08
48 0.12
49 0.11
50 0.15
51 0.2
52 0.2
53 0.21
54 0.21
55 0.2
56 0.17
57 0.17
58 0.16
59 0.1
60 0.1
61 0.1
62 0.1
63 0.11
64 0.1
65 0.1
66 0.08
67 0.08
68 0.07
69 0.07
70 0.06
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.08
82 0.08
83 0.08
84 0.08
85 0.08
86 0.07
87 0.07
88 0.08
89 0.11
90 0.16
91 0.17
92 0.2
93 0.28
94 0.3
95 0.31
96 0.32
97 0.32
98 0.29
99 0.32
100 0.32
101 0.31
102 0.28
103 0.28
104 0.26
105 0.22
106 0.19
107 0.14
108 0.12
109 0.06
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.1
116 0.13
117 0.13
118 0.18
119 0.19
120 0.19
121 0.21
122 0.21
123 0.18
124 0.14
125 0.14
126 0.08
127 0.08
128 0.08
129 0.06
130 0.08
131 0.08
132 0.08
133 0.09
134 0.14
135 0.16
136 0.17
137 0.18
138 0.18
139 0.21
140 0.22
141 0.22
142 0.18
143 0.19
144 0.21
145 0.27
146 0.26
147 0.25
148 0.27
149 0.31
150 0.33
151 0.31
152 0.29
153 0.27
154 0.31
155 0.32
156 0.38
157 0.33
158 0.31
159 0.31
160 0.3
161 0.26
162 0.2
163 0.18
164 0.12
165 0.12
166 0.12
167 0.11
168 0.11
169 0.11
170 0.11
171 0.12
172 0.1
173 0.09
174 0.07
175 0.06
176 0.07
177 0.07
178 0.07
179 0.05
180 0.05
181 0.06
182 0.08
183 0.08
184 0.08
185 0.09
186 0.09
187 0.11
188 0.16
189 0.2
190 0.25
191 0.3
192 0.34
193 0.39
194 0.4
195 0.42
196 0.4
197 0.45
198 0.46
199 0.51
200 0.56
201 0.61
202 0.68
203 0.73
204 0.8
205 0.82
206 0.82
207 0.79
208 0.75
209 0.73
210 0.74
211 0.74
212 0.7
213 0.63
214 0.58
215 0.55
216 0.51
217 0.46
218 0.43
219 0.39
220 0.41
221 0.42
222 0.46
223 0.48
224 0.49
225 0.55
226 0.56
227 0.59
228 0.57
229 0.58
230 0.6
231 0.62
232 0.69
233 0.65
234 0.65
235 0.61
236 0.62
237 0.59
238 0.52
239 0.52
240 0.49
241 0.46
242 0.46
243 0.48
244 0.48
245 0.51