Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

U5H2Z1

Protein Details
Accession U5H2Z1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-44TPKVAPQEKKKKVCGRAKKRILYNRRFHydrophilic
NLS Segment(s)
PositionSequence
18-37TPKVAPQEKKKKVCGRAKKR
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVRSQTPKVAPQEKKKKVCGRAKKRILYNRRFVNVTLAPGGKRRMNPNPEGKSGST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.42
4 0.43
5 0.46
6 0.54
7 0.57
8 0.62
9 0.62
10 0.65
11 0.72
12 0.75
13 0.76
14 0.76
15 0.77
16 0.77
17 0.8
18 0.8
19 0.8
20 0.81
21 0.84
22 0.81
23 0.81
24 0.8
25 0.8
26 0.77
27 0.75
28 0.71
29 0.65
30 0.6
31 0.52
32 0.5
33 0.42
34 0.36
35 0.31
36 0.25
37 0.23
38 0.25
39 0.29
40 0.26
41 0.29
42 0.34
43 0.41
44 0.46
45 0.54
46 0.61
47 0.63
48 0.64