Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

U5HEI3

Protein Details
Accession U5HEI3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-71QEMGFNSGKARKKKKKTKTTKDEKQIEDGKBasic
NLS Segment(s)
PositionSequence
49-62GKARKKKKKTKTTK
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKRHSGIRTAGQDNLSDHTMEVACSDVVDDRKPQLCKPSSLQEMGFNSGKARKKKKKTKTTKDEKQIEDGKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.27
3 0.19
4 0.17
5 0.15
6 0.14
7 0.12
8 0.11
9 0.08
10 0.07
11 0.07
12 0.07
13 0.08
14 0.09
15 0.1
16 0.11
17 0.13
18 0.18
19 0.2
20 0.21
21 0.27
22 0.27
23 0.29
24 0.32
25 0.36
26 0.34
27 0.34
28 0.34
29 0.3
30 0.3
31 0.31
32 0.28
33 0.21
34 0.2
35 0.24
36 0.31
37 0.35
38 0.44
39 0.51
40 0.61
41 0.72
42 0.81
43 0.86
44 0.91
45 0.93
46 0.94
47 0.95
48 0.94
49 0.94
50 0.93
51 0.85
52 0.83