Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A090CDL6

Protein Details
Accession A0A090CDL6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-34LYRQCLRECRKKPEATRKHFQTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045295  Complex1_LYR_SDHAF1_LYRM8  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20268  Complex1_LYR_SDHAF1_LYRM8  
Amino Acid Sequences MRLSGLQKEVLGLYRQCLRECRKKPEATRKHFQTFAREEFEKSISLDKRDFSAIEFLLRKGRRQLEMYASPGVKDIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.32
5 0.37
6 0.44
7 0.51
8 0.57
9 0.6
10 0.66
11 0.75
12 0.79
13 0.82
14 0.79
15 0.81
16 0.8
17 0.75
18 0.72
19 0.64
20 0.61
21 0.56
22 0.52
23 0.47
24 0.4
25 0.36
26 0.32
27 0.32
28 0.23
29 0.18
30 0.21
31 0.18
32 0.2
33 0.2
34 0.19
35 0.19
36 0.2
37 0.19
38 0.14
39 0.17
40 0.15
41 0.18
42 0.19
43 0.18
44 0.25
45 0.26
46 0.28
47 0.31
48 0.36
49 0.36
50 0.38
51 0.42
52 0.43
53 0.47
54 0.48
55 0.46
56 0.41
57 0.37
58 0.37