Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2T2Y7

Protein Details
Accession M2T2Y7    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGKRKSSSKPQGPKRKEKLPTTFQCLHydrophilic
NLS Segment(s)
PositionSequence
3-18KRKSSSKPQGPKRKEK
Subcellular Location(s) nucl 15, mito 8.5, cyto_mito 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKPQGPKRKEKLPTTFQCLFCNHENSVSVSIEKKSGVGNLQCKVCGQTFQTNINYLSAPVDVYADWIDACDAVAKQAAKGNAEVSRSSHRMGRMPTAHNQEDDDGDGGFIEHDDADAEGEYAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.86
4 0.85
5 0.83
6 0.83
7 0.8
8 0.78
9 0.77
10 0.69
11 0.65
12 0.57
13 0.52
14 0.46
15 0.43
16 0.35
17 0.3
18 0.29
19 0.27
20 0.28
21 0.24
22 0.2
23 0.18
24 0.18
25 0.17
26 0.15
27 0.13
28 0.11
29 0.12
30 0.15
31 0.18
32 0.22
33 0.24
34 0.25
35 0.25
36 0.24
37 0.25
38 0.21
39 0.18
40 0.17
41 0.2
42 0.22
43 0.26
44 0.27
45 0.27
46 0.27
47 0.25
48 0.22
49 0.15
50 0.13
51 0.09
52 0.08
53 0.06
54 0.06
55 0.05
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.07
68 0.07
69 0.08
70 0.11
71 0.12
72 0.12
73 0.13
74 0.15
75 0.15
76 0.17
77 0.17
78 0.17
79 0.22
80 0.23
81 0.24
82 0.25
83 0.24
84 0.28
85 0.3
86 0.35
87 0.35
88 0.37
89 0.43
90 0.48
91 0.47
92 0.43
93 0.42
94 0.35
95 0.31
96 0.28
97 0.22
98 0.14
99 0.12
100 0.1
101 0.09
102 0.07
103 0.06
104 0.05
105 0.04
106 0.04
107 0.05
108 0.05
109 0.06
110 0.07