Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2T247

Protein Details
Accession M2T247    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
7-28RDNMVRCPKTRTQRMPKRDLLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10.5, nucl 8.5, cyto_mito 8.166, cyto_nucl 7.166, cyto 4.5, cyto_pero 3.666
Family & Domain DBs
Amino Acid Sequences MGLGNVRDNMVRCPKTRTQRMPKRDLLSKGQVGPPLFFWFPSPGINKELPGDTRCSCVRTDRKETQPGNTNVCHDSTDHQYHSIPSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.55
3 0.64
4 0.68
5 0.7
6 0.76
7 0.84
8 0.84
9 0.84
10 0.79
11 0.76
12 0.7
13 0.66
14 0.63
15 0.57
16 0.51
17 0.46
18 0.43
19 0.36
20 0.32
21 0.26
22 0.23
23 0.2
24 0.17
25 0.16
26 0.14
27 0.14
28 0.17
29 0.18
30 0.16
31 0.19
32 0.19
33 0.18
34 0.18
35 0.18
36 0.17
37 0.16
38 0.18
39 0.16
40 0.19
41 0.2
42 0.2
43 0.19
44 0.26
45 0.34
46 0.37
47 0.46
48 0.5
49 0.57
50 0.65
51 0.66
52 0.64
53 0.65
54 0.62
55 0.58
56 0.52
57 0.48
58 0.39
59 0.39
60 0.32
61 0.24
62 0.23
63 0.26
64 0.3
65 0.29
66 0.3
67 0.3