Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2TFQ2

Protein Details
Accession M2TFQ2   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
74-95KAKSIKTKSKAGKKKEESSKEEBasic
NLS Segment(s)
PositionSequence
54-91RNPVIVLKKSSKRVSDALKMKAKSIKTKSKAGKKKEES
Subcellular Location(s) nucl 16, mito_nucl 11.999, cyto_nucl 11.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MSSSNATTPSITITNTEGNSRAISTNTFDAFLLSTHLTTMDDLAAAKQAKKDARNPVIVLKKSSKRVSDALKMKAKSIKTKSKAGKKKEESSKEEGFKMLKVVKVEHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.22
4 0.19
5 0.19
6 0.2
7 0.2
8 0.18
9 0.14
10 0.15
11 0.16
12 0.18
13 0.17
14 0.17
15 0.15
16 0.15
17 0.14
18 0.13
19 0.12
20 0.09
21 0.09
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.05
28 0.05
29 0.05
30 0.05
31 0.09
32 0.09
33 0.09
34 0.1
35 0.14
36 0.17
37 0.2
38 0.26
39 0.32
40 0.36
41 0.38
42 0.37
43 0.4
44 0.44
45 0.43
46 0.4
47 0.37
48 0.38
49 0.42
50 0.46
51 0.4
52 0.37
53 0.41
54 0.43
55 0.46
56 0.47
57 0.48
58 0.51
59 0.5
60 0.49
61 0.49
62 0.47
63 0.47
64 0.5
65 0.52
66 0.5
67 0.59
68 0.65
69 0.71
70 0.77
71 0.76
72 0.79
73 0.77
74 0.82
75 0.83
76 0.83
77 0.79
78 0.78
79 0.77
80 0.7
81 0.63
82 0.56
83 0.47
84 0.39
85 0.38
86 0.34
87 0.29
88 0.27