Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2U8I9

Protein Details
Accession M2U8I9    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKPKSTKKPKSAIKPKSNKKWTMYPSHydrophilic
NLS Segment(s)
PositionSequence
3-20PKSTKKPKSAIKPKSNKK
Subcellular Location(s) nucl 17, mito_nucl 13.166, cyto_nucl 11.166, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MKPKSTKKPKSAIKPKSNKKWTMYPSLHNEVSDLLYVDNLSFSFYEKDDANSCINEYDTNVMGRFTCSNTACLAVWTSKQIAITIRRYLDGGYNARVYYQSCKRCSTTSEPKLDDSYAERVAYRLKKWSGIQMELPPFSGLSNGPHRSDLCEGCKQGHFAPAHLRGHNCTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.93
4 0.93
5 0.89
6 0.84
7 0.83
8 0.77
9 0.77
10 0.71
11 0.68
12 0.66
13 0.66
14 0.61
15 0.51
16 0.45
17 0.36
18 0.32
19 0.24
20 0.17
21 0.09
22 0.08
23 0.09
24 0.08
25 0.07
26 0.06
27 0.06
28 0.06
29 0.08
30 0.09
31 0.09
32 0.12
33 0.11
34 0.14
35 0.15
36 0.17
37 0.17
38 0.16
39 0.16
40 0.14
41 0.14
42 0.12
43 0.11
44 0.11
45 0.1
46 0.11
47 0.1
48 0.1
49 0.1
50 0.11
51 0.11
52 0.1
53 0.14
54 0.14
55 0.15
56 0.15
57 0.16
58 0.15
59 0.14
60 0.14
61 0.1
62 0.1
63 0.1
64 0.1
65 0.1
66 0.1
67 0.1
68 0.13
69 0.16
70 0.19
71 0.2
72 0.2
73 0.19
74 0.19
75 0.19
76 0.18
77 0.18
78 0.16
79 0.15
80 0.16
81 0.16
82 0.16
83 0.16
84 0.14
85 0.17
86 0.23
87 0.28
88 0.3
89 0.33
90 0.35
91 0.36
92 0.4
93 0.43
94 0.46
95 0.47
96 0.51
97 0.5
98 0.5
99 0.5
100 0.45
101 0.37
102 0.29
103 0.26
104 0.2
105 0.19
106 0.17
107 0.16
108 0.23
109 0.26
110 0.24
111 0.27
112 0.27
113 0.31
114 0.33
115 0.41
116 0.39
117 0.38
118 0.4
119 0.39
120 0.42
121 0.38
122 0.38
123 0.29
124 0.24
125 0.21
126 0.19
127 0.13
128 0.13
129 0.22
130 0.24
131 0.25
132 0.28
133 0.28
134 0.31
135 0.36
136 0.36
137 0.33
138 0.37
139 0.37
140 0.38
141 0.41
142 0.39
143 0.36
144 0.38
145 0.32
146 0.28
147 0.36
148 0.4
149 0.43
150 0.43
151 0.44