Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2UWK6

Protein Details
Accession M2UWK6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-66ITSDKRDDWEQKRKRQKNKNRTKPGRLRQGYAHydrophilic
NLS Segment(s)
PositionSequence
46-61KRKRQKNKNRTKPGRL
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MRDLLRPRKLLLNGGRTLRVDCQDNKTKVSREGIITSDKRDDWEQKRKRQKNKNRTKPGRLRQGYARYYALVVEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.43
4 0.43
5 0.37
6 0.32
7 0.29
8 0.28
9 0.33
10 0.39
11 0.4
12 0.42
13 0.43
14 0.42
15 0.41
16 0.41
17 0.36
18 0.29
19 0.29
20 0.27
21 0.29
22 0.27
23 0.26
24 0.24
25 0.21
26 0.21
27 0.22
28 0.28
29 0.3
30 0.4
31 0.46
32 0.54
33 0.66
34 0.73
35 0.81
36 0.84
37 0.87
38 0.88
39 0.91
40 0.92
41 0.92
42 0.94
43 0.94
44 0.94
45 0.93
46 0.93
47 0.85
48 0.79
49 0.77
50 0.77
51 0.69
52 0.62
53 0.54
54 0.44
55 0.41