Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SJA7

Protein Details
Accession M2SJA7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-99TSNYPWDNCKWKRQCNNGHPENCWHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MKGLGFVAVYIIAIGMAKVNACASYKYCACSDNDTNNGFDDAATQYNCNGINVGELRWFDDNNGVRGRYYCETADTSNYPWDNCKWKRQCNNGHPENCWGKVHW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.07
8 0.08
9 0.1
10 0.11
11 0.16
12 0.17
13 0.19
14 0.2
15 0.2
16 0.21
17 0.27
18 0.3
19 0.31
20 0.34
21 0.33
22 0.33
23 0.32
24 0.3
25 0.23
26 0.18
27 0.13
28 0.1
29 0.11
30 0.1
31 0.1
32 0.09
33 0.11
34 0.11
35 0.09
36 0.08
37 0.06
38 0.08
39 0.08
40 0.09
41 0.09
42 0.09
43 0.1
44 0.11
45 0.11
46 0.09
47 0.15
48 0.16
49 0.18
50 0.2
51 0.18
52 0.18
53 0.19
54 0.23
55 0.18
56 0.19
57 0.17
58 0.17
59 0.19
60 0.2
61 0.24
62 0.21
63 0.21
64 0.24
65 0.24
66 0.22
67 0.23
68 0.26
69 0.32
70 0.35
71 0.44
72 0.48
73 0.57
74 0.67
75 0.74
76 0.81
77 0.81
78 0.88
79 0.87
80 0.83
81 0.75
82 0.74
83 0.7
84 0.62