Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TYK9

Protein Details
Accession M2TYK9    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-31VPQSRPGHCHSRRQKRHGTPKTLLRRRSBasic
54-74LAYRCPSSRHREQRTSKCMSTHydrophilic
NLS Segment(s)
PositionSequence
15-34RRQKRHGTPKTLLRRRSGRK
Subcellular Location(s) nucl 14.5, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MADVPQSRPGHCHSRRQKRHGTPKTLLRRRSGRKPSDDVLVLTRHMCYGEPPILAYRCPSSRHREQRTSKCMSTSRAGNPVCTCRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.73
3 0.79
4 0.84
5 0.84
6 0.9
7 0.89
8 0.87
9 0.83
10 0.83
11 0.85
12 0.82
13 0.76
14 0.72
15 0.72
16 0.7
17 0.74
18 0.74
19 0.7
20 0.69
21 0.7
22 0.64
23 0.59
24 0.52
25 0.42
26 0.35
27 0.28
28 0.22
29 0.17
30 0.15
31 0.11
32 0.1
33 0.09
34 0.07
35 0.1
36 0.12
37 0.11
38 0.12
39 0.15
40 0.15
41 0.15
42 0.16
43 0.16
44 0.16
45 0.21
46 0.25
47 0.3
48 0.4
49 0.51
50 0.58
51 0.64
52 0.72
53 0.79
54 0.82
55 0.82
56 0.73
57 0.69
58 0.64
59 0.59
60 0.55
61 0.51
62 0.48
63 0.49
64 0.48
65 0.46
66 0.47
67 0.48