Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2UDV5

Protein Details
Accession M2UDV5   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-52HFFTKNGKKLKPTTKKPKDTHKTRDLVBasic
NLS Segment(s)
PositionSequence
30-43KNGKKLKPTTKKPK
120-134RVKRVRKEEDKAWEK
Subcellular Location(s) nucl 14.5, mito_nucl 12.666, cyto_nucl 9.833, mito 9.5
Family & Domain DBs
Amino Acid Sequences MLSHYSTLFTKPRAQANQPRTPKSSHFFTKNGKKLKPTTKKPKDTHKTRDLVSRYLSSSRVTSIFQPTRKPNPMSPLGPQNYSTGTYRSSKKDTRGARSSTGQPEWYVTYRAIMDEEEKRVKRVRKEEDKAWEKEVRRDKEKYARDTLGKEGVFADVFVLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.6
3 0.65
4 0.72
5 0.72
6 0.73
7 0.68
8 0.65
9 0.63
10 0.58
11 0.57
12 0.55
13 0.53
14 0.54
15 0.6
16 0.66
17 0.68
18 0.71
19 0.67
20 0.66
21 0.69
22 0.74
23 0.75
24 0.75
25 0.78
26 0.8
27 0.87
28 0.86
29 0.89
30 0.88
31 0.87
32 0.86
33 0.84
34 0.78
35 0.69
36 0.72
37 0.64
38 0.57
39 0.5
40 0.42
41 0.35
42 0.32
43 0.31
44 0.24
45 0.21
46 0.19
47 0.17
48 0.16
49 0.16
50 0.23
51 0.27
52 0.28
53 0.33
54 0.37
55 0.44
56 0.49
57 0.49
58 0.43
59 0.44
60 0.47
61 0.43
62 0.39
63 0.4
64 0.36
65 0.34
66 0.32
67 0.27
68 0.23
69 0.23
70 0.21
71 0.13
72 0.14
73 0.17
74 0.19
75 0.23
76 0.28
77 0.3
78 0.33
79 0.4
80 0.44
81 0.49
82 0.52
83 0.51
84 0.49
85 0.49
86 0.5
87 0.47
88 0.43
89 0.35
90 0.29
91 0.27
92 0.26
93 0.24
94 0.2
95 0.15
96 0.15
97 0.14
98 0.14
99 0.13
100 0.11
101 0.13
102 0.15
103 0.2
104 0.26
105 0.26
106 0.29
107 0.35
108 0.41
109 0.46
110 0.52
111 0.58
112 0.61
113 0.68
114 0.73
115 0.77
116 0.78
117 0.73
118 0.69
119 0.65
120 0.56
121 0.59
122 0.61
123 0.58
124 0.57
125 0.58
126 0.61
127 0.64
128 0.7
129 0.68
130 0.66
131 0.64
132 0.62
133 0.61
134 0.58
135 0.56
136 0.47
137 0.4
138 0.33
139 0.29
140 0.24
141 0.21
142 0.16