Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2UT84

Protein Details
Accession M2UT84    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-24TEFRRAKYCHRSPPSSRQCIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.5, nucl 9, cyto 8, mito 7
Family & Domain DBs
Amino Acid Sequences MTVDTEFRRAKYCHRSPPSSRQCIARTSIACSNCSIPSCSPEPGFVVWRPNDYAYRRYPRKMTLVKWLSSCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.7
4 0.79
5 0.81
6 0.77
7 0.71
8 0.67
9 0.61
10 0.56
11 0.52
12 0.47
13 0.37
14 0.34
15 0.37
16 0.32
17 0.3
18 0.28
19 0.26
20 0.22
21 0.21
22 0.19
23 0.14
24 0.16
25 0.17
26 0.18
27 0.16
28 0.15
29 0.16
30 0.15
31 0.18
32 0.17
33 0.2
34 0.2
35 0.21
36 0.22
37 0.23
38 0.28
39 0.28
40 0.33
41 0.35
42 0.45
43 0.48
44 0.52
45 0.54
46 0.54
47 0.61
48 0.63
49 0.58
50 0.59
51 0.6
52 0.58