Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2ULX2

Protein Details
Accession M2ULX2    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-76DDEEEQKKKKKKKEGTSVLAYBasic
NLS Segment(s)
PositionSequence
62-68KKKKKKK
Subcellular Location(s) mito 19, nucl 5, cyto_nucl 4.5
Family & Domain DBs
Amino Acid Sequences MPPHRLSTSKCQINFLPKAPQRRSSLSHVPRNNSLAAAFRTTRSITPPKVDHIQEDDEEEQKKKKKKKEGTSVLAYLSLWKGVRSLWRGIDWYVGQMGSGWRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.51
3 0.51
4 0.48
5 0.57
6 0.57
7 0.6
8 0.57
9 0.57
10 0.58
11 0.56
12 0.62
13 0.61
14 0.65
15 0.63
16 0.62
17 0.6
18 0.57
19 0.5
20 0.39
21 0.31
22 0.25
23 0.21
24 0.2
25 0.17
26 0.15
27 0.17
28 0.18
29 0.18
30 0.2
31 0.24
32 0.22
33 0.26
34 0.27
35 0.29
36 0.32
37 0.32
38 0.28
39 0.26
40 0.26
41 0.22
42 0.23
43 0.21
44 0.18
45 0.19
46 0.19
47 0.21
48 0.26
49 0.33
50 0.38
51 0.45
52 0.54
53 0.62
54 0.72
55 0.78
56 0.81
57 0.81
58 0.8
59 0.73
60 0.63
61 0.53
62 0.42
63 0.33
64 0.23
65 0.18
66 0.12
67 0.1
68 0.1
69 0.11
70 0.18
71 0.2
72 0.24
73 0.25
74 0.27
75 0.29
76 0.29
77 0.32
78 0.26
79 0.24
80 0.22
81 0.18
82 0.16
83 0.15
84 0.16