Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2UQT4

Protein Details
Accession M2UQT4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-29ALVSPCRRRYFPRQFTRRYAVQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Pfam View protein in Pfam  
PF13489  Methyltransf_23  
Amino Acid Sequences MAGFSVRALVSPCRRRYFPRQFTRRYAVQAPGAPILEIFSAQQKWMQKERAAKDVETSRDVDYLRDEVASRLCERVLDINRHFPKVLDIGANACNLSRALTLPSEDAPEKGPRSKRIGTITAADSSRSLLYRDADLPFNKEIDIVREVLPTSELLPYEANTFDAVLSNLSLHWINDLPSVLAQINNILKPDCPFIGVMMGGDSLYELRTSLQLAELDRRGGVSTHTSPLADVKDVGGLLQKAGFNLLTVDVDDIVVDFPDTFSLMKDLQAMGESNAVLAREKGAIHRDVLLAAEGIYKELHGNEDGTLPATFRLIYMIGWKPSPNQQKPLERGTGMFSIKDYLEKNGGSGEGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.62
3 0.7
4 0.74
5 0.75
6 0.76
7 0.79
8 0.8
9 0.85
10 0.85
11 0.79
12 0.75
13 0.69
14 0.63
15 0.59
16 0.55
17 0.5
18 0.45
19 0.4
20 0.33
21 0.27
22 0.23
23 0.17
24 0.13
25 0.11
26 0.13
27 0.13
28 0.14
29 0.18
30 0.22
31 0.28
32 0.36
33 0.41
34 0.41
35 0.5
36 0.53
37 0.58
38 0.56
39 0.5
40 0.49
41 0.5
42 0.48
43 0.42
44 0.4
45 0.33
46 0.33
47 0.33
48 0.27
49 0.22
50 0.2
51 0.17
52 0.16
53 0.15
54 0.14
55 0.17
56 0.19
57 0.17
58 0.17
59 0.16
60 0.15
61 0.16
62 0.23
63 0.26
64 0.31
65 0.33
66 0.42
67 0.45
68 0.47
69 0.46
70 0.38
71 0.35
72 0.29
73 0.29
74 0.2
75 0.17
76 0.18
77 0.2
78 0.2
79 0.16
80 0.13
81 0.12
82 0.1
83 0.11
84 0.09
85 0.08
86 0.09
87 0.1
88 0.11
89 0.12
90 0.13
91 0.15
92 0.14
93 0.14
94 0.15
95 0.19
96 0.21
97 0.26
98 0.3
99 0.33
100 0.4
101 0.43
102 0.45
103 0.47
104 0.48
105 0.43
106 0.42
107 0.38
108 0.35
109 0.31
110 0.26
111 0.2
112 0.18
113 0.17
114 0.13
115 0.12
116 0.1
117 0.11
118 0.13
119 0.15
120 0.16
121 0.18
122 0.19
123 0.21
124 0.2
125 0.19
126 0.17
127 0.16
128 0.14
129 0.14
130 0.14
131 0.13
132 0.13
133 0.13
134 0.13
135 0.12
136 0.12
137 0.09
138 0.09
139 0.08
140 0.07
141 0.08
142 0.08
143 0.08
144 0.09
145 0.09
146 0.08
147 0.07
148 0.07
149 0.06
150 0.07
151 0.06
152 0.05
153 0.05
154 0.05
155 0.04
156 0.05
157 0.05
158 0.05
159 0.06
160 0.06
161 0.06
162 0.07
163 0.08
164 0.07
165 0.06
166 0.08
167 0.07
168 0.06
169 0.06
170 0.08
171 0.09
172 0.09
173 0.1
174 0.09
175 0.09
176 0.1
177 0.12
178 0.09
179 0.09
180 0.08
181 0.08
182 0.09
183 0.08
184 0.07
185 0.05
186 0.05
187 0.04
188 0.04
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.04
195 0.04
196 0.05
197 0.05
198 0.07
199 0.08
200 0.09
201 0.13
202 0.13
203 0.13
204 0.13
205 0.13
206 0.12
207 0.1
208 0.11
209 0.12
210 0.14
211 0.15
212 0.16
213 0.15
214 0.15
215 0.17
216 0.17
217 0.13
218 0.11
219 0.09
220 0.1
221 0.1
222 0.1
223 0.09
224 0.08
225 0.08
226 0.1
227 0.1
228 0.09
229 0.1
230 0.1
231 0.07
232 0.08
233 0.08
234 0.06
235 0.06
236 0.07
237 0.06
238 0.06
239 0.06
240 0.05
241 0.05
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.05
248 0.05
249 0.05
250 0.08
251 0.08
252 0.09
253 0.1
254 0.1
255 0.1
256 0.11
257 0.11
258 0.09
259 0.1
260 0.1
261 0.08
262 0.09
263 0.09
264 0.08
265 0.08
266 0.08
267 0.09
268 0.09
269 0.13
270 0.16
271 0.18
272 0.18
273 0.2
274 0.19
275 0.18
276 0.18
277 0.15
278 0.11
279 0.09
280 0.11
281 0.08
282 0.09
283 0.08
284 0.08
285 0.09
286 0.09
287 0.11
288 0.1
289 0.11
290 0.11
291 0.12
292 0.12
293 0.13
294 0.12
295 0.11
296 0.1
297 0.1
298 0.09
299 0.08
300 0.1
301 0.08
302 0.09
303 0.14
304 0.2
305 0.21
306 0.23
307 0.24
308 0.25
309 0.34
310 0.45
311 0.45
312 0.48
313 0.55
314 0.64
315 0.68
316 0.72
317 0.68
318 0.59
319 0.54
320 0.5
321 0.48
322 0.39
323 0.34
324 0.27
325 0.24
326 0.24
327 0.27
328 0.23
329 0.21
330 0.25
331 0.24
332 0.24
333 0.23
334 0.23