Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2UCH8

Protein Details
Accession M2UCH8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
4-29NELPACQKCKLRKVRCDRQAPKCTSCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences GMSNELPACQKCKLRKVRCDRQAPKCTSCTKGNVACIVVNPATGEQYARDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.75
4 0.81
5 0.84
6 0.88
7 0.87
8 0.86
9 0.86
10 0.82
11 0.75
12 0.69
13 0.63
14 0.56
15 0.51
16 0.44
17 0.41
18 0.39
19 0.37
20 0.35
21 0.33
22 0.28
23 0.26
24 0.25
25 0.19
26 0.16
27 0.14
28 0.12
29 0.12
30 0.12
31 0.12