Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2U6G8

Protein Details
Accession M2U6G8   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
83-109ATTILKNRKKRLAARKTRERLNQQRLLHydrophilic
NLS Segment(s)
PositionSequence
88-101KNRKKRLAARKTRE
Subcellular Location(s) mito 12.5, mito_nucl 11.333, nucl 9, cyto_nucl 7.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVRTPPDITSAWNFRSFSAGARVPRARRIEKIQQPPPTNPHGCPRRNHTGPFRFLELPQEIRDEIYSYLVVRQTPHSPPILDATTILKNRKKRLAARKTRERLNQQRLLEGKRPTCPHSTSTSTNHPDPILHVDLLRTSQKLADEATDCMYSKNVFAISLDKLPLTSFDAPPGWDLSRIKRLQIELQLKDAIRMNRYVDWSSFFSSFPSLQFLRLVPTLHPRYYEWSRCEFTEWASKETPFVHKAFFRELLVAIPSYVDLKIGLPRDLLAPAGGGGAVHEVQVQGKLGIDDKFLWDMYLELGNRLGVTGKPLAYNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.34
4 0.3
5 0.31
6 0.33
7 0.3
8 0.38
9 0.45
10 0.44
11 0.51
12 0.56
13 0.53
14 0.55
15 0.6
16 0.63
17 0.66
18 0.73
19 0.73
20 0.74
21 0.75
22 0.75
23 0.72
24 0.7
25 0.64
26 0.57
27 0.59
28 0.59
29 0.6
30 0.6
31 0.62
32 0.64
33 0.65
34 0.69
35 0.7
36 0.69
37 0.69
38 0.67
39 0.64
40 0.55
41 0.5
42 0.5
43 0.43
44 0.37
45 0.32
46 0.31
47 0.26
48 0.24
49 0.24
50 0.19
51 0.15
52 0.14
53 0.13
54 0.11
55 0.14
56 0.14
57 0.15
58 0.14
59 0.17
60 0.2
61 0.23
62 0.25
63 0.25
64 0.24
65 0.24
66 0.27
67 0.26
68 0.21
69 0.19
70 0.2
71 0.23
72 0.26
73 0.31
74 0.32
75 0.36
76 0.43
77 0.5
78 0.54
79 0.57
80 0.65
81 0.7
82 0.77
83 0.81
84 0.85
85 0.84
86 0.85
87 0.83
88 0.82
89 0.82
90 0.8
91 0.77
92 0.67
93 0.67
94 0.62
95 0.59
96 0.55
97 0.5
98 0.44
99 0.42
100 0.44
101 0.42
102 0.43
103 0.4
104 0.36
105 0.37
106 0.39
107 0.37
108 0.39
109 0.44
110 0.43
111 0.42
112 0.4
113 0.34
114 0.29
115 0.26
116 0.26
117 0.19
118 0.16
119 0.15
120 0.14
121 0.14
122 0.16
123 0.15
124 0.1
125 0.09
126 0.1
127 0.1
128 0.11
129 0.11
130 0.1
131 0.1
132 0.11
133 0.12
134 0.12
135 0.12
136 0.11
137 0.11
138 0.1
139 0.08
140 0.08
141 0.07
142 0.06
143 0.06
144 0.08
145 0.09
146 0.1
147 0.1
148 0.09
149 0.09
150 0.09
151 0.09
152 0.11
153 0.12
154 0.11
155 0.13
156 0.13
157 0.14
158 0.14
159 0.15
160 0.12
161 0.12
162 0.13
163 0.16
164 0.24
165 0.24
166 0.25
167 0.25
168 0.26
169 0.28
170 0.35
171 0.38
172 0.31
173 0.33
174 0.35
175 0.32
176 0.32
177 0.32
178 0.26
179 0.2
180 0.2
181 0.2
182 0.2
183 0.23
184 0.23
185 0.2
186 0.21
187 0.22
188 0.23
189 0.22
190 0.19
191 0.17
192 0.17
193 0.17
194 0.14
195 0.16
196 0.14
197 0.14
198 0.15
199 0.15
200 0.16
201 0.17
202 0.17
203 0.14
204 0.23
205 0.27
206 0.26
207 0.28
208 0.26
209 0.32
210 0.38
211 0.44
212 0.39
213 0.4
214 0.41
215 0.4
216 0.43
217 0.36
218 0.32
219 0.34
220 0.32
221 0.3
222 0.3
223 0.3
224 0.28
225 0.3
226 0.32
227 0.26
228 0.25
229 0.25
230 0.26
231 0.29
232 0.32
233 0.31
234 0.27
235 0.25
236 0.24
237 0.21
238 0.2
239 0.17
240 0.12
241 0.1
242 0.09
243 0.09
244 0.09
245 0.07
246 0.06
247 0.07
248 0.12
249 0.15
250 0.15
251 0.14
252 0.15
253 0.16
254 0.16
255 0.15
256 0.11
257 0.09
258 0.08
259 0.08
260 0.07
261 0.05
262 0.05
263 0.07
264 0.07
265 0.06
266 0.07
267 0.07
268 0.08
269 0.09
270 0.1
271 0.08
272 0.09
273 0.1
274 0.12
275 0.13
276 0.14
277 0.14
278 0.16
279 0.18
280 0.17
281 0.16
282 0.14
283 0.13
284 0.13
285 0.18
286 0.15
287 0.14
288 0.15
289 0.15
290 0.15
291 0.14
292 0.14
293 0.09
294 0.13
295 0.16
296 0.17