Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2UX86

Protein Details
Accession M2UX86    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-65FCRWSYVPSRWKKKRYHVSQMSSCWRTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences TVAKKTYNSGDSPVVSHLTTSPPVKDLTCGERTRASDLFCRWSYVPSRWKKKRYHVSQMSSCWRTGGFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.19
4 0.16
5 0.15
6 0.17
7 0.17
8 0.16
9 0.16
10 0.17
11 0.17
12 0.18
13 0.17
14 0.19
15 0.25
16 0.24
17 0.25
18 0.28
19 0.29
20 0.31
21 0.3
22 0.26
23 0.23
24 0.24
25 0.28
26 0.25
27 0.27
28 0.23
29 0.25
30 0.27
31 0.3
32 0.38
33 0.41
34 0.52
35 0.59
36 0.67
37 0.72
38 0.8
39 0.84
40 0.84
41 0.85
42 0.84
43 0.84
44 0.84
45 0.83
46 0.82
47 0.73
48 0.64
49 0.53