Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2UL66

Protein Details
Accession M2UL66    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
50-75LESMRRIGLRNKRGRKPQWRWTEKTGHydrophilic
NLS Segment(s)
PositionSequence
57-68GLRNKRGRKPQW
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MFWGCFSYDKKGPCHVYQPETKAEKEDAARRIEQLNAELEPLQREEWELLESMRRIGLRNKRGRKPQWRWTEKTGKLVRTSRGGIDWWRYQTCVLIPKLIPFAKECLQDRPQTVVMEDKAPSHAHHYQSVIYRLHDVERLLWCGNSPDSPQSRAEAVRVWQNCWRDLSQLKIQAWIERILIHIQKIIELQGGNEYIEGRDKPRLRRPYIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.54
3 0.55
4 0.59
5 0.59
6 0.6
7 0.57
8 0.54
9 0.49
10 0.44
11 0.41
12 0.39
13 0.42
14 0.38
15 0.39
16 0.4
17 0.38
18 0.38
19 0.35
20 0.31
21 0.26
22 0.23
23 0.19
24 0.19
25 0.18
26 0.17
27 0.16
28 0.16
29 0.14
30 0.12
31 0.13
32 0.12
33 0.12
34 0.12
35 0.11
36 0.1
37 0.13
38 0.13
39 0.13
40 0.14
41 0.13
42 0.14
43 0.22
44 0.31
45 0.38
46 0.48
47 0.57
48 0.63
49 0.73
50 0.81
51 0.84
52 0.84
53 0.83
54 0.84
55 0.83
56 0.81
57 0.79
58 0.8
59 0.72
60 0.72
61 0.68
62 0.61
63 0.59
64 0.58
65 0.51
66 0.45
67 0.44
68 0.34
69 0.3
70 0.28
71 0.23
72 0.24
73 0.25
74 0.24
75 0.23
76 0.22
77 0.21
78 0.21
79 0.2
80 0.21
81 0.19
82 0.18
83 0.18
84 0.19
85 0.23
86 0.23
87 0.21
88 0.16
89 0.19
90 0.19
91 0.23
92 0.23
93 0.24
94 0.27
95 0.29
96 0.29
97 0.3
98 0.28
99 0.24
100 0.24
101 0.21
102 0.18
103 0.18
104 0.17
105 0.13
106 0.13
107 0.14
108 0.14
109 0.17
110 0.2
111 0.2
112 0.22
113 0.23
114 0.24
115 0.26
116 0.3
117 0.26
118 0.22
119 0.22
120 0.2
121 0.2
122 0.19
123 0.16
124 0.16
125 0.16
126 0.19
127 0.17
128 0.17
129 0.16
130 0.16
131 0.16
132 0.14
133 0.14
134 0.18
135 0.2
136 0.23
137 0.24
138 0.23
139 0.25
140 0.24
141 0.24
142 0.2
143 0.19
144 0.24
145 0.25
146 0.26
147 0.28
148 0.3
149 0.31
150 0.32
151 0.31
152 0.29
153 0.3
154 0.34
155 0.36
156 0.4
157 0.38
158 0.4
159 0.4
160 0.38
161 0.38
162 0.33
163 0.27
164 0.2
165 0.22
166 0.21
167 0.22
168 0.2
169 0.2
170 0.18
171 0.19
172 0.19
173 0.19
174 0.16
175 0.14
176 0.14
177 0.15
178 0.15
179 0.14
180 0.14
181 0.14
182 0.12
183 0.17
184 0.17
185 0.17
186 0.26
187 0.31
188 0.4
189 0.5
190 0.59