Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TJD2

Protein Details
Accession M2TJD2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
207-231GENVHVDKKKPKKKAQLEAEKEHLQBasic
NLS Segment(s)
PositionSequence
214-220KKKPKKK
Subcellular Location(s) cyto 12.5, cyto_nucl 11.5, nucl 9.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039470  Nuc_deoxyri_tr2  
Pfam View protein in Pfam  
PF15891  Nuc_deoxyri_tr2  
Amino Acid Sequences MRGKKTEPEPKVPEGVDIDQDVEDVKNQLPPLPSPLPTPHKDFIHCVPPNAPTYRKFSVFTAGSIEMGNAVQWQKHMVASLSHLPIIVCNPRRGHWNPNITPQARDKDFKDQVEWELSALEQVDVICFFFDVTTKSPVSLLELGLWAGSGKVVVCCGEGYWKGGNVELTCDRYDIPFVKSFAELVPAVEKMLVDKGMVLDAKGDLVGENVHVDKKKPKKKAQLEAEKEHLQRQIDALQEQLAESKVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.42
3 0.35
4 0.29
5 0.26
6 0.2
7 0.2
8 0.17
9 0.13
10 0.12
11 0.11
12 0.11
13 0.13
14 0.13
15 0.17
16 0.18
17 0.19
18 0.26
19 0.27
20 0.28
21 0.29
22 0.37
23 0.4
24 0.42
25 0.47
26 0.45
27 0.45
28 0.47
29 0.47
30 0.44
31 0.47
32 0.45
33 0.4
34 0.37
35 0.37
36 0.39
37 0.39
38 0.38
39 0.3
40 0.36
41 0.38
42 0.39
43 0.37
44 0.33
45 0.37
46 0.34
47 0.31
48 0.29
49 0.25
50 0.22
51 0.21
52 0.19
53 0.12
54 0.11
55 0.1
56 0.07
57 0.07
58 0.07
59 0.07
60 0.09
61 0.09
62 0.1
63 0.11
64 0.09
65 0.1
66 0.13
67 0.18
68 0.17
69 0.16
70 0.16
71 0.15
72 0.14
73 0.16
74 0.2
75 0.18
76 0.21
77 0.23
78 0.24
79 0.31
80 0.34
81 0.39
82 0.4
83 0.47
84 0.45
85 0.52
86 0.59
87 0.52
88 0.52
89 0.48
90 0.46
91 0.39
92 0.4
93 0.33
94 0.36
95 0.4
96 0.38
97 0.35
98 0.31
99 0.3
100 0.3
101 0.27
102 0.18
103 0.13
104 0.12
105 0.1
106 0.08
107 0.06
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.06
119 0.08
120 0.11
121 0.11
122 0.11
123 0.11
124 0.11
125 0.14
126 0.13
127 0.11
128 0.09
129 0.09
130 0.09
131 0.08
132 0.08
133 0.05
134 0.04
135 0.03
136 0.03
137 0.03
138 0.03
139 0.04
140 0.04
141 0.05
142 0.05
143 0.05
144 0.08
145 0.09
146 0.11
147 0.12
148 0.13
149 0.13
150 0.14
151 0.16
152 0.12
153 0.16
154 0.16
155 0.18
156 0.17
157 0.17
158 0.16
159 0.15
160 0.18
161 0.16
162 0.17
163 0.19
164 0.19
165 0.2
166 0.2
167 0.2
168 0.17
169 0.19
170 0.15
171 0.12
172 0.13
173 0.11
174 0.11
175 0.11
176 0.11
177 0.08
178 0.1
179 0.09
180 0.07
181 0.08
182 0.08
183 0.1
184 0.11
185 0.09
186 0.09
187 0.08
188 0.09
189 0.08
190 0.08
191 0.05
192 0.06
193 0.06
194 0.06
195 0.07
196 0.08
197 0.12
198 0.14
199 0.17
200 0.25
201 0.36
202 0.45
203 0.53
204 0.62
205 0.7
206 0.79
207 0.87
208 0.89
209 0.89
210 0.89
211 0.86
212 0.83
213 0.79
214 0.7
215 0.64
216 0.57
217 0.47
218 0.4
219 0.36
220 0.33
221 0.29
222 0.28
223 0.25
224 0.22
225 0.21
226 0.2
227 0.19