Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2B4P6

Protein Details
Accession B2B4P6    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
96-117SHPLPLRRRLWRSCRRQGQCAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, mito 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036527  SCP2_sterol-bd_dom_sf  
KEGG pan:PODANSg7988  -  
Amino Acid Sequences MSLANDKFPSSAAFDAINQAISASDADRKEAIKAGNAVFAFVLKNKAGETDEWHIDLKNKGAVGKGLGEKPTGMFTPEKNKNWKDCLLMCVVCGNSHPLPLRRRLWRSCRRQGQCAETVHVWQAQDQGRCHEGYQAGSYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.19
3 0.18
4 0.17
5 0.13
6 0.12
7 0.1
8 0.09
9 0.1
10 0.07
11 0.12
12 0.12
13 0.14
14 0.15
15 0.16
16 0.16
17 0.2
18 0.19
19 0.18
20 0.21
21 0.2
22 0.23
23 0.22
24 0.21
25 0.17
26 0.17
27 0.14
28 0.11
29 0.14
30 0.09
31 0.1
32 0.09
33 0.11
34 0.12
35 0.12
36 0.16
37 0.17
38 0.18
39 0.19
40 0.2
41 0.18
42 0.2
43 0.2
44 0.16
45 0.13
46 0.13
47 0.12
48 0.12
49 0.12
50 0.11
51 0.13
52 0.14
53 0.14
54 0.14
55 0.13
56 0.13
57 0.13
58 0.13
59 0.1
60 0.1
61 0.09
62 0.1
63 0.2
64 0.27
65 0.31
66 0.37
67 0.41
68 0.43
69 0.47
70 0.48
71 0.43
72 0.37
73 0.36
74 0.33
75 0.29
76 0.25
77 0.23
78 0.2
79 0.16
80 0.14
81 0.17
82 0.12
83 0.16
84 0.19
85 0.23
86 0.27
87 0.34
88 0.4
89 0.44
90 0.52
91 0.57
92 0.65
93 0.69
94 0.76
95 0.79
96 0.83
97 0.8
98 0.81
99 0.78
100 0.75
101 0.71
102 0.64
103 0.58
104 0.49
105 0.45
106 0.39
107 0.34
108 0.27
109 0.21
110 0.25
111 0.26
112 0.3
113 0.29
114 0.32
115 0.32
116 0.33
117 0.33
118 0.31
119 0.28
120 0.26